Isoprenoid synthases

专利摘要:
The invention relates to the field of genetic engineering of flavor, fragrance and biocontrol agent development. More specifically it relates to a process for production of natural flavors, fragrances or bio-control agents by the control of one or more genes implicated in that process. The invention provides an isolated or recombinant nucleic acid or functional fragment thereof encoding a proteinaceous molecule essentially capable of flavor, fragrance and/or bio-control agent synthesis when provided with a suitable substrate under appropriate reaction conditions. The invention further provides a nucleic acid or functional fragment thereof encoding a proteinaceous molecule essentially capable of synthesizing at least a monoterpene alcohol linalool when contacted with geranyl diphosphate (GPP) and/or at least a sesquiterpene alcohol nerolidol when contacted with farnesyl diphosphate (FPP) under appropriate reaction conditions.
公开号:CA2437863A1
申请号:C2437863
申请日:2002-02-12
公开日:2002-08-22
发明作者:Asaph Aharoni；Maarten Anthonie Jongsma；Henricus Adrianus Verhoeven；Hendrik Jan Bouwmeester
申请人:Plant Research International B.V.；Asaph Aharoni；Maarten Anthonie Jongsma；Henricus Adrianus Verhoeven；Hendrik Jan Bouwmeester；Enza Zaden Beheer B.V.；De Ruiter Seeds R&D B.V.；Monsanto Invest N.V.；
IPC主号:C12N9-88

专利说明:
[1" class="description-paragraph] Title: Isoprenoid synthases The invention relates to the field of genetic engineering of flavor, fragrance or bio-control agent development. More specifically it relates to a process for production of bioactive isoprenoid compounds by the control or modulation of one or more genes implicated in that process.Isoprenoids are the largest and most diverse group of plant secondary compounds. At least 20,000 isoprenoids have been described and without doubt many more will be discovered in the future. By definition isoprenoids are made up of socalled isoprene (C5) units. This can be recognized in the number of C-atoms present in the isoprenoids which usually can be divided by five (C5, C10, C15, C20, C25, C30 and C40), although also irregular isoprenoids and polyterpenes have been reported.Important members of the isoprenoids a.o. are the carotenoids, gibberellins, abscisic acid, some cytokinins, sterols, and the terpenoids, consisting of a.o. monoterpenes, sesquiterpenes, diterpenes, triterpenes, tetraterpenes and polyterpenes (rubbers), etc. Most of these compounds occur free but they can also be modified, or derivatized as esters and glycosides, or attached to proteins. Among the isoprenoids there are many compounds with biological activity, for example as plant growth regulator (gibberellins, abscisic acid, cytokinins), and in the interaction between plants and other organisms (for example as anti-microbials, infochemicals and as the isoprenoid germination stimulants that are exuded by the roots of some plant species and induce the germination of parasitic weed seeds).Mono- and sesquiterpenes, the C10 and C15 branch of the isoprenoid family, were investigated for their economically interesting value as flavor and fragrance compounds in foods and cosmetics and their anti-carcinogenic and antimicrobial properties. Mono- and sesquiterpenes have also been shown to be of ecological significance, for instance in the interaction between plants, plants and insects/spider mites and plants and microorganisms. Therefore, plants producing mono- and sesquiterpenes have been investigated by many authors and this has resulted in a better understanding of the biochemical pathways leading to the formation of these compounds and their derivatives.
[2" class="description-paragraph] 2 Linalool is an acyclic monoterpene alcohol that has a peculiar creamy floral, sweet taste. In Clarkia breweri (Onagraceae) linalool, amongst other compounds, is responsible for the attraction of pollinating moths. Linalool is one of the volatile compounds released as a semiochemical after herbivore attack in some plants and as such may attract predators of the herbivores. The sweet taste of linalool makes it suitable to enhance the blueberry flavor of foodstuffs especially of beverages (US Patent 4041185). Furthermore, linalool is known to have a broad-spectrum antimicrobial activity. It is reported by Pattnaik et al. (lllicrobios 89: 39-46, 1997) to display antibacterial activity against Gram-positive and Gram-negative bacteria as well as antifungal activity against yeast-like and filamentous fungi. Nerolidol, the sesquiterpene analogue of the monoterpenoid linalool, is a component of many essential oils and flower headspaces (Bauer et al., Common Fragrance and Flavor Materials. Preparations, Properties and Uses, VCHVerlaggesellschaft, Weinheim, Germany, 1990; Knudsen et al., Phytochemistry 33:253-280, 1993). Nerolidol has been reported to have anti-microbial activity. EP0420630A2 describes the use of nerolidol in an antiplaque oral composition.Bouwmeester et al (Plant Physiol. 121: 173-180, 1999) for cucumber and Lima bean and Degenhardt and Gershenzon (Planta 210: 815-822, 2000) for maize showed that nerolidol biosynthesis is induced upon respectively spider mite or Spodoptera feeding.The enzyme responsible for the formation of nerolidol catalyses the regulatory step in the formation of the important signalling molecule 4,8-dimethyl-1,3(E~,7-nonatriene.Both nerolidol and 4,8-dimethyl-1,3(E~,7-nonatriene are important constituents of the volatile blend produced in maize upon feeding of beet army worm larvae (Turlings et al., Science 250: 1251-1253, 1990; Degenhardt and Gershenzon, 2000) and in gerbera in response to feeding of spider mites (Krips et al., J. Chem Ecol 1999). Also in the headspace of several flowers, nerolidol is an important constituent often together with 4,8-dimethyl-1,3(E~,7-nonatriene (Kaiser, In: Perfumes: Art, Science and Technology, Elsevier Science Publishers, Essex, UK, pp 213-250, 1991; Knudsen et al., 1993). Nerolidol has also been reported as a constituent of pheromone mixtures of a number of insects and spider mites (Aldrich-JR; Lusby-WR; Kochansky-JP, Experientia. 1986, 42: 5, 583-585; Regev-S; Cone-WW. Environmental-Entomology
[3" class="description-paragraph] 3 1976, 5: 1, 133-138) and has been described as being miticidal if formulated in a controlled release substrate (US patent 4775534).Also, nerolidol has been reported to be an extremely effective repellent of mosquitoes. From a number of plants, several cDNAs encoding enzymes involved in the biosynthesis of monoterpenoids have been isolated such as S-linalool and R-linalool synthases (Cseke et al., Mol. Biol. Evol. 15: 1491-1498, 1998; Jia et al., Arch Biochem Biophys 372: 143-149, 1999), (-)-4S limonene synthase (Colby et al., J Biol Chem 268:23016-23024, 1993; Bohlmann et al., J Biol Chem 272: 21784-21792, 1997). WO 9715584 describes the use of S-linalool synthase, an acyclic monoterpene synthase, in the genetic engineering of scent production. The use of the limonene (monoterpene) cyclase in the control of corn rootworm, by inserting a nucleotide sequence coding for limonene cyclase into the plants is described in WO 9637102. In WO 0022150 the use of a limonene synthase, linalool synthase and combination of limonene and carveol synthase (actually called limonene hydroxylase) for the control of insects is described. However, terpenoid products were only formed in combination with a GPP synthase.The enzymes involved in the production of precursors for the synthesis of the primary monoterpene skeletons are all active in the plastids, since all cloned genes of this pathway until now have plastid targeting signals. Recently, for one enzyme, (4S)-limonene synthase, localisation in the leucoplasts of the secretory cells in Mentha spicata has been demonstrated with immunogold labeling. The plastid targeting signals indicate that isoprenoid precursors for monoterpene metabolism are formed in the plastids, although some partitioning of these precursors between the different cellular compartments in plants has been shown to occur. Unlike other monoterpene (and diterpene) cyclases that bear cleavable transit peptides of 50-70 amino acids, the S-linalool synthase cDNA isolated by Pichersky and co-workers encodes a protein with an apparent cleavable peptide of maximally only eight amino acids long.Nevertheless, typical plastid targeting signal characteristics were found in the first
[4" class="description-paragraph] 4 PCT/NL02/00089 60 amino acids of the cDNA, supporting that the linalool synthase enzyme, as expected for a monoterpene synthase, is indeed targeted to the plastids. Two independent cDNA clones encoding 5-epi-aristolochene synthase (EAS) from tobacco have been isolated and characterised by Facchini and Chappell (Pros Natl Acad. Sci. USA, 89:11088-11092, 1992). Back and Chappell described the cloning and bacterial expression of vetispiradiene synthase found in Hyoscyamus muticus (J. Baol.Chem., 270(13):7375-7381, 1995). The cDNA encoding amorpha-4,11-diene synthase, an intermediate in the biosynthesis of the anti-malarial artemisinin, was isolated and characterised by Mercke et al. (Arch. Baochem. Biophys., 381(1):173-180, 2000).Sesquiterpene biosynthesis is compartmentalised to the cytosol, and none of the sofar isolated sesquiterpene synthases bear any targeting signal. Farnesyl diphosphate (FPP) is present in every living organism and it is the precursor of a large number of primary and secondary metabolites. It has been established that FPP is the precursor of all sesquiterpenoids. There are several thousands of different sesquiterpenoid compounds identified in many living organisms. Examples are the bitter sesquiterpene lactones such as sonchuside A and C, and cichorilide A in chicory (De Kraker et al., Plant Physvol 117: 1381-1392, 1998). The first committed step in the biosynthesis of these compounds is catalysed by a germacrene A synthase which. was cloned from chicory (PCT/EP 0002130). Other examples are the cloning of three sesquiterpene synthases ((L~-a-bisabolene, 8-selinene , and y-humulene synthase) from grand fir (WO 99/37139; Bohlmann et al., proc Natl Acad Sci, USA, 95: 6761), and a germacrene C synthase from tomato (Colby et al., Pr~c Natl Acad Sci, USA, 95: 2216-2221). The use of the amorpha-4,11-dime synthase in the engineering of artemisinin biosynthesis is described in EP 0 982 404 A1. However, the putative sesquiterpene synthase responsible for the formation of the biologically important nerolidol has never been cloned.The use of recombinant DNA technology to introduce resistance based on secondary metabolites in plants has had only limited success. For example, Hain et al (Nature 361, 153-156, 1993) succeeded in introducing fungal resistance in a number of plant species by the introduction of the resveratrol synthase cDNA, that they isolated from grape. Although there are reports on the anti-microbial and insecticidal effects of specific terpenoids, resistance against fungi as a result of the expression of a terpene synthase in plants has not been reported sofar. The invention provides an isolated or recombinant nucleic acid or functional fragment thereof encoding a proteinaceous molecule essentially capable of isoprenoid bioactive compound (herein also identified as flavor, fragrance and/or bio-control agent) synthesis when provided with a suitable substrate under appropriate reaction conditions. Presently, the main way to produce plant flavor (for ease of reference with flavor also fragrances are generally meant) compounds is by the synthetic route.Synthetic organic chemicals constitute more than 80-90% (by weight and value) of the raw materials used in flavor and fragrance formulations. However, problems often exist concerning production. Extraction from intact plants and conventional fermentation are currently providing alternative routes for the commercial production of flavor/ aroma chemicals. However, the demand for natural flavors by the consumer has been steadily increasing, and demand often outstrips supply. In many cases sought after flavor compounds can not easily be isolated. An under-standing of the precursors and characterization of genes encoding enzymes involved in diverse pathways leading to the formation of flavors is essential for the production of natural flavors. The nucleic acids and their encoded proteinaceous molecules of the present invention are involved in the biosynthetic pathway for terpenoid production and as such they provide new means and methods for the in-uiuo and in-vitro biotechnological production of bio-flavours, natural flavor chemicals and bio-control compounds.In addition the nucleic acids and their encoded proteinaceous molecules of the present invention and products synthesized are essentially capable acting as potent bio-control agents alone or in combination. Fungi and bacteria have become an increasing threat to humans. Opportunistic microbial infections have increased dramatically in the last two decades and have become a significant cause of morbidity and mortality. Over recent years, the frequency of life-threatening fungal infections has increased dramatically, making fungal infections now responsible for nearly 40% of all deaths from hospital-acquired infections. Increased numbers of patients with an impaired immune system (such as due to ageing, severe burns, AIDS, chemotherapy against cancer, or immunosuppressive therapy for organ transplants), together with a growing list of potential pathogenic fungi and bacteria are recognized as factors contributing to this rising public health-hazard. There is only a limited set of bio-control compounds available, and resistance to existing bio-control drugs is becoming a problem of increasing concern. Also clinically used antimycotics may show harmful side effects.Fungi are responsible for substantial economic losses due to food spoilage caused by highly dangerous toxins (mycotoxins). To add to this problem food additives to prevent fungal contamination may also be potentially carcinogenic. Additionally plant pathogenic micro-organisms cause huge crop losses and this has promoted the extensive use of pesticides all over the world. Some pesticides have deleterious effects on other organisms than the pests they are intended to control, on water quality, and on the environment in general. Current antimicrobials are often not specific enough, and several microbial species exhibit increasing resistance to these pesticides. There is a need to develop new and more advanced bio-control agents with novel modes of action and broad spectra directed against plant and animal pathogens. The nucleic acids and their encoded proteinaceous molecules of the present invention involved in terpenoid biosynthesis, as such provide a new method for the in-viuo and in-vitro biotechnological production of natural and more specific anti-microbials or bio-control agents, for example antifungals. , The nucleic acid as used herein refers to an oligonucleotide, nucleotide or polynucleotide, and fragments or portions thereof, and to DNA or RNA of genomic or synthetic origin which may be single- or double-stranded, and represents the sense or antisense strand. A proteinaceous molecule as used herein refers to a molecule comprising peptide or protein. Natural flavor synthesis as used herein refers to flavor and fragrance compounds synthesized that are identical to their natural counterparts. Natural counterpart as used herein refers to products that are obtained directly from plants and sometimes from animal sources by physical procedures. Synthetic flavors refers to nature identical compounds that are produced synthetically but are chemically identical to their natural counterpart. Nature-identical compounds are with few exceptions the only synthetic compounds used in flavors in addition to natural products. Artificial flavor synthesis refers to flavor compounds that have not been identified in plant or animal products for human consumption. The nucleic acids of the present invention pave the way for the production of artificial flavors using techniques known in the art such as for example combinatorial biosynthesis, metabolic pathway engineering, gene shuffling, directed evolution of proteins etc. Bio-control synthesis as used herein refers to bio-control compounds synthesized which can act as an bio-control agent. A bio-control agent as used herein refers to a compound, which can at least in part suppress or inhibit or restrict the growth of a pathogenic organism (e.g. fungi, bacteria etc.), that is a compound that has anti-pathogenic activity.The invention further provides for a nucleic acid or functional fragment thereof wherein said nucleic acid encodes a proteinaceous molecule essentially capable of synthesizing at least a monoterpene alcohol linalool when contacted with geranyl diphosphate (GPP) and/or at least a sesquiterpene alcohol nerolidol when contacted with farnesyl diphosphate (FPP) under appropriate reaction conditions. The definition 'functional fragment thereof means that a particular subject sequence may vary from the reference sequence by one or more substitutions, deletions, or additions, the net effect of which does not result in an adverse functional dissimilarity between the reference and the subject sequence. It may be advantageous to produce a nucleic acid according to the invention or derivatives thereof possessing a substantially different codon usage. It is known by those skilled in the art that as a result of degeneracy of the genetic code, a multitude of gene sequences, some bearing minimal homology to the nucleotide sequences of any known and any naturally occur-ring genes may be produced. The invention includes possible variation of the nucleic acid sequence that could be made by selecting combinations based on possible codon choices. In addition deliberate amino acid substitution may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, and/or the amphipathetic nature of the residues as long as the biological activity of the polypeptide is retained.In a preferred embodiment said nucleic acid encodes a terpene cyclase which has a combined nerolidol and linalool synthesizing capacity. Nerolidol is a sesquiterpene analog of the monoterpenoid linalool. The enzymes involved in the production of precursors for the synthesis of the primary monoterpene skeletons have been shown to be active in the plastids. The ability of said terpene cyclase to synthesize linalool Sappears to be influenced by the presence of a plastid targeting signal sequence that is rich in hydroxylated and basic residues. Sesquiterpene biosynthesis is compartmentalised to the cytosol, and none of the sofar isolated sesquiterpene syntheses bear any targeting signal. However, the present invention shows that monoterpenes can also be produced by cytosolic monoterpene syntheses. Apparently the substrate GPP is present in the cytosol. The invention shows that the production of sesquiterpenes in the cytosol is hampered by a lack of substrate. The co-expression of a cytosolic FPP-synthase or the transformation with a fusion construct of sesquiterpene synthase and FPP synthase is now provided to overcome this problem.An additional solution is the targeting of sesquiterpene biosynthesis to other cell compartments by adding or changing a targeting signal to/of the sesquiterpene synthase and/or co-transformation of an FPP synthase with the same targeting or transformation with a targeted fusion construct of sesquiterpene synthase and FPPsynthase. In addition to FPP synthase, other enzymes catalyzing committed steps in the biosynthesis of GPP and FPP through the mevalonate and non-mevalonate pathway can be coupled to or co-expressed with monoterpene and sesquiterpene syntheses to increase the levels of monoterpenes and/or sesquiterpenes produced.These enzymes can be directed (by adding, changing and removing targeting signals) to different compartments (i.e. mitochondria, chloroplasts, chromoplasts, leucoplasts, peroxisomes (see also example 7).The invention thus provides a nucleic acid according to the invention encoding a proteinaceous molecule provided with a targeting signal, such as a plastid targeting or a mitochondrial targeting signal, or a targeting signal to any other or ganel or a nucleic acid according to the invention encoding a proteinaceous molecule without such signal, depending on where synthesis is required. The invention thus provides a nucleic acid according to the invention encoding a proteinaceous molecule essentially capable of isoprenoid bio-active compound synthesis in the cytosol in a cell when provided with a suitable substrate under appropriate reaction conditions. Similarly, it provides a nucleic acid according to the invention encoding a proteinaceous molecule essentially capable of isoprenoid bio-active compound synthesis in a plastid in a cell or in a mitochondrium in a cell when provided with a suitable substrate under appropriate reaction conditions. In a preferred embodiment said nucleic acid as provided herein is provided with a nucleic acid encoding a targeting signal and/or remnants of a targeting signal.Preferably said targeting signal is a plastid targeting signal. Said plastid targeting signal is preferably located in the N terminus (N-terminal transit peptide) and may have a high abundance of serine residues and/or theronine and/or a low number of acidic residues and/or rich in hydroxylated and basic residues. In one preferred embodiment said targeting signal has a F (Phe), K (Lys), V (Val), F (Phe), N (Asn) motif and/or a D (asp) S (Ser), L (Leu), L (Leu), Xaa, S (Ser), S (Ser) motif, where Xaa is preferably P(pro) or S (Ser). In another, the target signal RRxxxxxxxxW is preferred. In particular the invention provides a nucleic acid encoding an essentially sesquiterpene synthase bioactive fragment, said nucleic acid provided with a targeting signal to provide the encoded gene product with monoterpene synthase activity, or a nucleic acid encoding an essentially monoterpene synthase bioactive fragment, said nucleic acid deprived from an essentially plastid targeting signal to provide the encoded gene product with sesquiterpene synthase activity, and thus provides the various enzymes with a different activity as would be expected. It is understood that through convergent or divergent evolution new proteins with altered functions may be created by this route. The mutations that lead to divergence are mostly single base substitutions that engender individual amino acid replacements, although other events leading to deletions or insertions also occur. The mutations may be in a nucleic acid comprising the transit peptide and/or the open reading frame (ORF). The new protein usually contains many of the pre-existing features. The original biological function may be restored by reversing mutations (e.g.single base substitutions) using techniques known in the art (e.g. site directed mutagenesis). In a preferred embodiment through a single base substitution in a predecessor sequence of said nucleic acid sequence (e.g. H64NORL) the N-terminal transit peptide is restored. Restored as used herein means that a stop codon in the target signal is removed, for example through a single base substitution, so that translation begins at the first ATG (Met) upstream of the target signal/transit sequence or target signal remnant. The predecessor sequence of said nucleic sequence is a sequence (common ancestor sequence) which has a stop codon in the target signal or the target signal remnant so that the translation of the protein begins at a second ATG (Met) truncating the target signal or the target signal remnant. It is conjectured that the presence of the restored target signal or target signal remnant influences the synthesis of linalool and/or nerolidol.
[5" class="description-paragraph] 5 The invention provides for a nucleic acid according to the invention wherein said proteinaceous molecule comprises a terpene synthase/cyclase. Preferably said proteinaceous molecule comprises a terpene synthase (cyclase), the properties of which should resemble those of other terpene synthases (cyclases). The invention further provides a nucleic acid according to the invention wherein said proteinaceous 10 molecule comprises a sesquiterpenoid synthase/cyclase. Sesquiterpenoid synthases/cyclases participate in the biosynthesis of most sesquiterpenoids.Ionization of FPP to the farnesyl cation is the first step in the biosynthesis of a large number of sesquiterpenes. The products of many of the sesquiterpenoid synthases/cyclases catalyzing the formation of a terpenoid skeleton from the respective diphosphate substrates (FPP) are mostly cyclic hydrodrocarbons, with a few exceptions such as for example the acyclic sesquiterpene alcohol nerolidol. None of the sofar isolated sesquiterpene synthases bear any targeting signal. The invention further comprises a nucleic acid according to the invention wherein said proteinaceous molecule comprises a nerolidol synthase/cyclase protein or functional fragment thereof. The nerolidol synthase/cyclase protein is essentially capable of the synthesis of the acyclic sesquiterpene alcohol nerolidol. The invention provides a nucleic acid wherein said nerolidol synthase/cyclase comprises (3S~-(E~-nerolidol synthase. The invention further comprises a nucleic acid according to the invention wherein said sesquiterpene alcohol nerolidol comprises trans-nerolidol. The invention further comprises a nucleic acid according to the invention wherein said monoterpene alcohol linalool comprises S-linalool. The invention provides for a nucleic acid according to the invention wherein said nucleic acid encodes a proteinaceous molecule comprising an amino acid sequence or functional fragment thereof that is at least 50% identical to sequence, more preferred 53 or 60% homologous, and even more preferred 70, 80, 90, 95 or 99% homologous to the sequence as shown in Figure 2 or functional fragment thereof. 1~ Homology is generally over the full-length of the relevant sequence shown herein. As is well-understood, homology at the amino acid level is generally in terms of amino acid similarity or identity. Similarity allows for "conservative variation", i. e.substitution of one hydrophobic residue such as isoleucine, valine, leucine or methionine for another, or the substitution of one polar residue for another, such as arginine for lysine, glutamic for aspartic acid, or glutamine for asparagine. Deliberate amino acid substitution may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, andlor the amphipathetic nature of the residues as long as the biological activity of the polypeptide is retained. In a preferred embodiment, all percentage homologies referred to herein refer to percentage sequence identity, e.g.percent (%) amino acid sequence identity with respect to a particular reference sequence can be the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent 1b sequence identity, without considering any conservative substitutions as part of the sequence identity. Amino acid similarity or identity can be determined by genetic programs known in the art. The invention further provides a nucleic acid or functional fragment thereof according to the invention wherein said nucleic acid encodes a proteinaceous molecule essentially capable of the synthesis of at least one monoterpenoid when contacted with geranyl diphosphate (GPP) under appropriate reaction conditions. The invention further provides a nucleic acid according to the invention wherein said nucleic acid encodes a proteinaceous molecule essentially capable of the synthesis of at least one monoterpenoid, wherein said monoterpenoid comprises a-pinene and/or I3-pinene (bicyclic terpene hydrocarbons) and/or sabinene and/or I3-myrcene (acyclic monoterpene) and/or a-phellandrene and/or I3-phellandrene and/or a-terpinolene and/or a-terpineol and/or ~-terpinene. Preferably said proteinaceous molecule comprises a terpene synthase (cyclase), the properties of which should resemble those of other terpene synthases (cyclase). Even more preferred said proteinaceous molecule comprises a monoterpenene synthase/cyclase. Preferably said monoterpenoid comprises an olefinic monoterpenoid. The invention further comprises a nucleic acid according to the invention wherein said nucleic acid encodes a proteinaceous molecule comprising an amino acid sequence or functional fragment thereof that is at least 50% identical to SOSVsequence (see figure 6), more preferred 53 or 60% homologous, and even more preferred 70, ~0 or 90 % homologous to the sequence as shown in figure 6 or functional fragment thereof. Preferably said nucleic acid does not contain an insertion of two cytosine residues causing a frame-shift followed by a stop codon giving rise to a truncated open reading frame (ORF), as depicted in figure 6 and 7. The invention further comprises a nucleic acid encoding a proteinaceous molecule according to the invention obtainable from a eukaryote. A eukaroyte as used herein comprises a cell or organism with a membrane-bound, structurally discrete nucleus and other well-developed subcellular compartments. Eukaryotes as used herein include all organisms except viruses, bacteria, and cyanobacteria (blue-green algae). Preferably said nucleic acid is obtainable from strawberry and/or maize and/or tea and/or cucumber and/or lima bean and/or cotton and/or thyme species and/or citrus species and/or eucalypt species andlor grapefruit and/or fungi andlor yeasts. The invention further comprises a nucleic acid encoding a proteinaceous molecule according to the invention obtainable from a prokaroyte. A prokaryote as used herein comprises a cell or organism lacking a membrane- bound, structurally discrete nucleus and other subcellular compartments e.g. bacteria, including archaebacteria and cyanobacteria (blue green algae). The invention further comprises a nucleic acid encoding a proteinaceous molecule according to the invention obtainable from invertebrate animals. An arthropod is a member of a phylum of invertebrate animals that includes insects, arachnids (spiders and mites e.g. spider mites (Tetranychus urticae), aphids (e.g. Aphis gossypii, Myzus persicae), and thrips (Frankliniella occidentalis) and crustaceans (crabs, lobsters, pillbugs, shrimp, etc.). In a preferred embodiment said nucleic acid encoding a proteinaceous molecule according to the invention is obtainable from strawberry. The invention further provides a nucleic acid according to the invention wherein said nucleic acid expression is repressed by auxin during fruit maturation. Indole-3-acetic acid or auxin is a plant hormone that plays key roles in regulating cell division, extension, and differentiation. The invention provides a proteinaceous molecule encoded by a nucleic acid according to the invention. The invention further provides a vector comprising a nucleic acid according to the invention. Preferably said vector is a recombinant expression vector comprising a coding sequence which is operably linked to a promoter sequence capable of directing expression of said coding sequence in a host cell for said vector, and a transcription termination sequence, in which the coding sequence is a nucleic acid according to the invention. Preferably said nucleic acid has been provided with means for nuclear targeting and/or integration in a host genome. Methods which are well known in the art can be used to construct expression vectors containing the nucleic acid of the invention, and appropriate transcriptional and translational controls. These methods include in-vitro recombinant techniques. Exogenous transcriptional elements and initation codons can be used and also can be of various origins, both natural and synthetic. The efficiency of expression may be enhanced by the inclusion of enhancers appropriate to the cell system in use. In the case of plant expression vectors, the expression of a nucleic acid of the invention may be driven by a number of previously defined and yet to be defined promoters, including inducible and developmentally regulated promoters. The invention further contemplates the use of the individual promoters of the nucleic acid of the present invention for this purpose. In particular any promoters particularly responsive to ripening events, wound-inducible or specific inducible promoters (e.g. spider mite, insect etc. inducible promoters, which can be isolated from plants that were fed upon by for example spider mites or insects), may be used to drive the tissue specific expression of said nucleic acid. In addition, viral promoters such as the 35S and the 19S promoters of CaMV may be used alone or in combination with the omega leader sequence from TMV. Promoters or enhancers derived from the genomes of plant cells, tissue specific promoters i.e fruit specific promoters, Fbp7 (Columbo et al. 1997; Plant Cell 9; 703-715), 2A11 promoter (Pear et al., 1989, Plant Molecular Biology, 13:639-651), small subunit of Rubisco (Corruzzi et al., 1984;EMBO ~l 3:16; Brogue et al., 1984 Science 224:838-843) or timing specific promoters such as ripening specific promoters (the E8 promoter, Diekman and Fisher, 1988, EMBO J, 7:3315-3320) may be used. Suitable terminator sequences include that of the Agrobacterium tumefaciens nopaline synthase gene (Nos 3' end), the tobacco ribulose bisphosphate carboxylase small subunit termination region; and other 3' regions known in the art. Methods known in the art can be used to construct recombinant vectors which will express 'sense' or 'antisense' nucleic acid. Antisense or partial sense or other techniques may also be used to reduce the expression of said nucleic acid leading to the production of a flavour, fragrance and/or bio-control compound. Full length sense techniques may be used to increase or reduce the expression of said nucleic acid leading to the production of a flavor and bio-control compound.The invention further provides a replicative cloning vector comprising a nucleic acid according to the invention and a replicon operative in a host cell for said vector.The invention contemplates the use of yet non-described biological and non biological based expression systems and novel hosts) systems that can be can be utilized to contain and express the nucleic acid of the invention. The definition host cell as used herein refers to a cell in which an foreign process is executed by bio-interaction, irrespective of the cell belongs to a unicellular, multicellular, a differentiated organism or to an artificial cell, cell culture or protoplast.The invention further provides a host comprising a nucleic acid according to the invention or a vector according to the invention. A variety of vector/host expression systems can be utilized to contain and express the nucleic acid of the invention. These include micro-organisms such as bacteria (e.g. E coli, B subtilis, Streptomyces, Pseudomonads) transformed with recombinant bacteriophage, plasmid or cosmid DNA expression systems, yeast (e.g S. cerevisiae, KluyUeromyces lactis, Pachia pastoris, Hansenula polymorpha, Schizosacch. Pombe, 1'arrowia) transformed with yeast expression vectors; filamentous fungi (Aspergillus nidulans, Aspergallus orizae, Aspergillus niger) transformed with filamentous fungi expression vectors, insect cell systems transfected with virus expression vectors (eg baculovirus, adenovirus, herpes or vaccinia viruses); plant cell systems transfected with virus expression vectors (e.g.cauliflower mosaic virus, CaMV, tobacco mosaic virus, TM~ or transformed with bacterial expression vectors (e.g Ti or Pbr322 plasmid); or mammalian cell systems (chinese hamster ovary (CHO), baby hamster kidney (BHK), Hybridoma's, including cell lines of mouse, monkey, human and the like. A host strain may be chosen for its ability to modulate the expression of the nucleic acid or to process the expressed proteinaceous molecule in the desired fashion. Such modifications of said proteinaceous molecule include acylation, carboxylation, glycosylation, 5 phosphorylation and lipidation. Post translation processing which cleaves a 'prepro' form of said proteinaceous molecue may also be important for correct insertion, folding and/or function. Different host cells which have the correct cellular machinery and characteristic mechanisms for such post-translational activities maybe chosen to ensure correct modification and processing of the introduced, foreign proteinaceous 10 molecule.The invention further provides a host comprising a nucleic acid according to the invention or a vector according to the invention wherein said host comprises a prokaroytic cell. The invention further provides a host comprising a nucleic acid according to the invention or a vector according to the invention wherein said host l5 comprises a eukaryotic cell.The invention further provides a host comprising a nucleic acid according to the invention or a vector according to the invention wherein said host comprises a plant and propagating material thereof. The invention is particularly useful for enabling plants to produce linalool, nerolidol or a combination of the two. This enables breeding of plants with improved fl.avor/fragrance as described for linalool alone in WO 971554, or improved resistance against micro-organisms or insects as described in Examples 8, 9, 12, 13 and 14 and WO 0022150 for linalool that had however to be co-expressed with a GPP synthase.The bacterial diseases to which resistance is provided herein include but are not limited to:Erwinaa spp. (e.g. E. amylouora (fire blight) and E. carotouora) , Clauibacter spp. (e.g.C. michiganense pv. Sepedonicum (bacterial ringspot potato), Corynebacterium spp., Pseudomonas spp. (e.g. P. syrangae pv. tomato), Xanthomonas spp. (X. campestras and X. uesicatonia), and Agrobacterium spp.The fungal diseases to which resistance is provided herein include but are not limited to: l6 Powdery mildew fungi (Sphaerotheca spp. (e.g. S. pannosa var. rosa. (rose), S. humuli (hop), S. fuliginea (cucurbits)), Podosphaera leucotricha (apple), Uncinula necator (grape), Erysiphe spp.(e.g. E. cichoracearum (cucurbits, tomato), E. polygoni (beet)), Leveillula taurica (tomato), Microsphaera euonymi (squash)), Botrytis spp. (e.g. B.cinerea (grey mold)), Cladosporium spp. (e.g. C. fulvum (in tomato)), Sphaeropsis spp. (e.g. Sphaeropsis sapinea (tip blight of pine), Cercospora spp. (C. beticola in beet, C. zeae-maydis in corn, C. sorghi in sorghum) , Fusarium spp. (e.g. F. oxysporum f.niveum (wilt on watermelon) F, graminearum and F: moniliforme (scab on wheat) F.moniliforme, F. oxysporum, F. subglutinans, F. proliferatum), anthracnose diseases (Apiognomonia veneta (in Sycamore, ash, oak, maple, and walnut ), Colletotrichum trifolii (Alfalfa anthracnose), Colletotrichum coccodes (black dot in potato)), rust diseases (e.g. Puccinia recondita (leaf rust in wheat) and Urornyces appendiculatus (rust in bean)), Phytophtora spp. (P. infestans (late blight on potato), P. sojae (blight on soybean), P. megasperma f. sp. medicaginis (root rot in alfalfa)), spoilage fungi (Gibberella spp., Diplodia spp., Penicillium, Aspergillus spp. Penicillium spp., Peacilomyces spp.), Vertici.llium spp. (e.g. V. albo-atrum (black root rot in strawberry), Septoria spp. (e.g. S. tritici and S. avenge ~ sp. triticea (Septoria in wheat), S. lycopersici (Septoria leaf spot in tomato)), Sclerotinia spp. (e.g. S.sclerotiorurn (white mold of beans), Aphanomyces spp. (e.g.A. cochlioides (root rot in sugar beet), Alternaria spp. (e.g. A. solani (early blight in tomato), Magnaporthe spp.(e.g. M. grisea (blast in rice)) Insects The insects to which resistance is provided herein include but are not limited to Lepidoptera, Orthoptera, Homoptera, Hemiptera, especially squash bugs (Anasa tristis); green stink bug (Acrosternum hilare); Riptortus cLavatus ; Coleoptera, especially, Colorado potato beetle (Leptinotarsa deeemlineata); three-lined potato beetle (Lema trilineata); asparagus beetle (Crioceris asparagi); Mexican bean beetle (Epilachna varivestis); red flour beetle (Tribolium castaneum); confused flour beetle (Tibolium confusum); the flea beetles (Chaetocnema spp., Haltica spp. and Epitrix spp.); corn rootworm (Diabrotica Spp.); cowpea weevil (Callosobruchus maculatus);boll weevil (Anthonomus grandis); rice weevil (Sitophilus oryza); maize weevil (Sitophilus zeamais); granary weevil (Sitoplailus granarius); Egyptian alfalfa weevil (Hypera postica); bean weevil (Acanthoscelides obtectus); lesser grain borer (R)tyzopertha dominica); yellow meal worm (Tenebrio molitor ); Thysanoptera, especi-ally, western flower thrips (Frankliniella occidentalis); Diptera, especially, leafminer spp. (Liriomyza trifolii); plant parasitic nematodes especially the potato cyst nematodes (Globodera spp.), the beet cyst nematode (Heterodera schachtii) and root knot nematodes (Meloidogyne spp.).Resistance can de determined by performing the appropriate test with the particular organism but can be predicted as well by determining terpene content such as demonstrated in figure 30 and example 13 herein.Plant as used herein refers to eukaryotic, autotrophic organisms. They are characterized by direct usage of solar energy for their primary metabolism, their permanent cell wall and in case of multicellular individuals their open unlimited growth. In case of heterotrophic plants, the organisms are in an evolutionary context essentially derived from autotrophic plants in their structure and metabolism. The invention provides a plant or a part, such as a stem, leave, tuber, root, fruit or seed or propagating material thereof transformed with the expression vector according to the invention.The invention further provides a plant or part thereof which contains within its ge-nome a vector according the invention. The invention provides a host comprising a nucleic acid according to the invention or a vector according to the invention wherein said host comprises a plant cell. 'Plant cell' as used herein is any self propagating cell bounded by a semi permeable membrane and containing one or more plastids. Such a cell requires a cell wall if further propagation is required. Plant cell as used herein may be part of a whole plant or may be an isolated cell or part of a tissue which may be regenerated into a whole plant and includes for example, seeds, suspension cultures, embryos, meristematic regions, callous tissues, protoplasts, leaves, roots, shoots, gametophytes, sporophytes, pollen and microspores. The vector constructs according to the invention can be introduced into plant cells by direct DNA transformation, or pathogen mediated transfection. The procedure or method for preparing a transformant can be performed according to the conventional technique used in the fields of molecular biology, biotechnology and genetic engineering. Manipulation of nucleic acid in plant cells may be carried out using the Cre/lox site specific recombination system as outlined in patent application W09109957. The target plant may be selected from any monocotyledonous or dicotyledonous plant species.Exemplary plants include potato, tomato, petunia, maize, sorghum, cotton, soybean, beans, rape, alfalfa, asparagus, sweet potato and chrysanthemum. However, it is not to be construed as limiting, in as much as microbes and insects may infest many other crops. Thus, the methods of the invention are readily applicable to numerous plant species, if they are found to be susceptible to the microbes or insect species listed hereinabove, including without limitation, species from the genera Medicago, Trifolium, Vigna, Citrus, Daucus, Arabidopsis, Brassica, Raphanus, Sinapis, Capsicum, Lycopersicon, Nicotiana, Solanum, Helianthus, Bromus, Asparagus, Panicum, Pennisetum, Cucumis, Glycine, Lolium, Triticum and Zea.The invention further provides a host comprising a nucleic acid according to the invention or a vector according to the invention wherein said host comprises an insect cell. Insect cells such as silkworm cells or larvae themselves may be used as a host.For example in one such system, Autographa californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign nucleic acid in Spodoptera frugiperda cells or in Trichoplusia larvae. The nucleic acid of the invention may be cloned into the nonessential region of the virus, such as the polyhedrin gene, and placed under control of a polyhedrin promoter. Successful insertion of the nucleic acid will render the polyhedrin gene inactive and produce recombinant virus lacking coat protein coat.The recombinant viruses are then used to infect S frugiperda cells or Trichoplusia larvae in which the nucleic acid is expressed [Smith et al. (1993) J Virol 46:584; Engelhard et al. (1994) Proc. Natl acad Sci, 91: 3224-7].The invention further provides a host wherein said vector according to the invention and said host expresses a nerolidol synthaselcyclase protein or polypeptide.Preferably said host exhibits suitable glycosyltransferase activity, whereby the produced linalool and nerolidol is converted and accumulated or stored in said host as its respective linaloylglycoside and nerolidylglycoside. Preferably said host contains the appropriate (inducible) glycosidase enzyme suitable for the release of the respective linalool and nerolidol. Alternatively said host is provided with a nucleic acid coding for a suitable (inducible) glycosidase enzyme. Host which contain a nucleic acid encoding a proteinaceous molecule according to the invention may be identified by a variety of procedures known in the art. These procedures include, but are not limited to DNA-DNA, DNA-RNA hybridisation, amplification using probes (portions or fragments of said nucleic acid), protein bioassay or immunoassay techni-ques which include membrane, solution or chip based technologies for the detection and/or quantification of said nucleic acid and encoded proteinaceous molecule.The invention further provides a host wherein said vector according to the invention and said host expresses a monoterpenene synthase/cyclase protein or polypeptide. The invention provides a method for producing a flavor, fragrance and/or bio-control compound comprising a) transforming or transfecting a suitable host with at least one nucleic acid encoding a proteinaceous molecule according to the invention b) expressing said nucleic acid in the presence of a suitable substrate c) optionally isolating the formed product. In a preferred embodiment said nucleic acid includes a restored target signal or a target signal remnant, i.e. in those case where plastid targeting is required. In a preferred embodiment of the invention is a method to produce nerolidol and /or linalool and/or oc-pinene and/or !3-pinene (bicyclic terpene hydrocarbons) andlor sabinene and/or I3-myrcene (acyclic monoterpene) and/or a-phellandrene and/or I3-phellandrene and/or a-terpinolene and/or a-terpineol and/or ~y-terpinene or mixtures thereof by a) transforming/transfecting a suitable host b) expressing at least one nucleic acid of the invention in the presence of a suitable substrate and c) isolating the formed products. In a preferred embodiment said host exhibits suitable glycosyltransferase activity, whereby the produced linalool and/or nerolidol is converted and accumulated or stored in said host as its respective linaloylglycoside and nerolidylglycoside. It is most easy when said host already contains the appropriate (inducible) glycosidase enzyme suitable for the release of the respective linalool and nerolidol. This is however not required, expression without said glycosyltransferase and/or glycosidase activity is perfectly well suitable for most purposes and alternatively said host may even be provided with a nucleic acid coding for a suitable glycosidase enzyme, when deemed required. For bio-control acitivity, it is even provided to express the compounds according to the invention without said glycosyltransferase and/or glycosidase activity, and let the bio-control activity partly depend on said activity in the target organism, e.g. after uptake by an insect the insects saliva, or on the induction of said activity after herbivory or fungal infection. A method for producing a compound according to the invention is provided comprising a) transforming or transfecting a suitable host with at least one nucleic 5 acid encoding a proteinaceous molecule according to the invention b) expressing said nucleic acid in the presence of a suitable substrate c) optionally isolating the formed product, wherein said host comprises a microorganism, plant cell or plant. Micro-organism as used herein refers to microscopic organisms such as for example Archaea, Bacteria, Cyanobacteria, Microalgae, Fungi, Yeast, Viruses, Protozoa, Roti-10 fers, Nematodes, Micro-Crustaceans, Micro-Molluscs, Micro-Shellfish, Micro-insects etc. The invention provides a method for producing a flavor, fragrance and or bio-control compound in a cell-free lysate expression system comprising expressing at least one nucleic acid encoding a proteinaceous molecule according to the invention in 15 the presence of a suitable substrate and optionally isolating the formed product, wherein said free lysate system contains all the components necessary for expression and processing. Cell-free lysate expression system as used herein refer to cell-free translation/translocation systems known in the art, such as for example rabbit reticulocyte lysate translation system.20 The invention further provides a flavor and/or bio-control compound obtainable by a method according to the invention. Preferably said flavor and/or bio-control compound comprises at least a nerolidol andlor linalool and/or a-pinene and/or f3-pinene (bicyclic terpene hydrocarbons) and/or sabinene and/or I3-myrcene (acyclic monoterpene) and/or a-phellandrene and/or !3-phellandrene and/or a-terpinolene and/or a-terpineol and/or y-terpinene or mixtures thereof. The invention further provides use of a flavor compound according to the invention in the processed food industry as an additive. Preferably as a food additive to enhance the flavor of syrups, ice-creams, ices, frozen desserts, yogurts, pastries, sauces, sweets, confectionery, baked goods etc., and like products, for example the enhancement of blueberry flavor (US Patent 4041185). Strawberry is a popular fruit for natural flavor ingredients because of its flavor, fragrance, aroma and scent. The invention provides the use of the nucleic acid according to the invention, for the industrial production of 'fruit' flavors which are natural to match the odor fidelity of the natural fruit. The invention provides for the production of novel flavors, fragrances and/or bio-control agents by the use of the nucleic acid according to the invention, alone or in combination, to provide novel avenues for production. For example, the natural or the stereochemically pure nerolidol may be used as a substrate for the semi-synthesis of flavor and fragrance compounds or insect repellents as described in US Patent 0051.96200A). The compounds of the present invention may be used to replace potentially carcinogenic synthetic food additives currently used. The invention provides use of a flavor and/or bio-control compound according to the invention as a disinfectant additive for example to obtain natural formulations and compositions such as antiplaque oral compositions as described in EP 0420630). The invention further provides use of a flavor and/or bio-control compound according to the invention as a degreasing solvent and/or plasticiser and/or dye carrier. The invention further provides use of a flavor and/or bio-control compound according to the invention as a flavoring and/or bio-control agent for oral medications and vitamins. The invention further provides use of a flavor compound according to the invention for providing additional flavor/aroma in beverages, including alcoholic and non-alcoholic beverages.The invention further provides use of a flavor compound according to the invention for enhancing or reducing plant flavor/aroma/fragrance/scent.The invention further provides use of a flavor compound according to the invention for enhancing the flavor/aroma of natural products and/or synthetic products and/or artificial products. The invention further provides use of a flavor compound according to the invention for the industrial synthesis of nature identical flavor/aroma substan-ces. In a preferred embodiment said flavor compound of the present invention is used for the production of novel combinations of artificial flavor substances.The invention provides use of a flavor and/or bio-control compound according to the invention as a pest control agent. Pest as used herein is a general term for organisms (rats, insects, mites, micro-organisms etc.) which may cause illness or damage or consume food crops and other materials important to humans/animals.The nucleic acid of the present invention pave the way through plant breeding to produce crops at least more capable of controlling or even eliminating detrimental pest infestations by enabling them to produce more terpenoid volatiles (plant volatile allelochemicals) to repel the attacking pest and/or to attract natural pest enemies to the crop. Preferably said terpenoid volatiles comprise nerolidol and/or linalool. The flavor and/or bio-control compounds of the present invention can be used as insecticides, insect repellents, insect pheromones, miticides, scabicides, antimicrobial agents, anti-fungals, anti-herbivore feeding agents etc. For example, nerolidol has been reported to be an extremely effective repellent of mosquitoes. Formulations containing natural nerolidol, produced according to the present invention, may therefore be used in mosquito control.In a preferred embodiment said compound according to the invention is used for control of the a) interaction between plants and insects b) interaction between plants and micro-organisms c) interaction between one plant and another.The invention provides use of a flavor and/or bio-control compound according to the invention as an anti-microbial agent. Anti-microbial agent as used herein refers to a compound which can at least in part suppress or inhibit or restrict the growth of a pathogenic organism (e.g. fungi, bacteria, yeast etc.).Preferably said compound may be used together with at least one other compound having anti-microbial activity to augment or supplement said anti-microbial activity (e.g. said compound can act synergistically with at least one other anti-microbial compound). The use of synergistic combinations of anti-microbial agents has many advantages. One such advantage is that it minimizes the known risk associated with the use of potentially deleterious anti-microbial agents which can be used in lower dosages to achieve the same effect. It also lowers risks associated with the use of non specific/non-selective anti-microbial agents, for example as additives in food and non food products. Preferably said compound can be used for crop treatment programs to reduce or eliminate the use of harmful pesticides/biocides [e.g. spray treatments]. It can be incorporated into products as an bio-control agent [e.g. household materials, detergents, food products etc.] or applied to products [e.g. as an external coating to leather products etc.] to reduce risk of spoilage or contamination. The invention further provides use of a flavor compound according to the invention for providing flavorlaroma in cosmetics (inc. soap perfumes, perfume specialties and bases), creams, sun-protectant products, hair conditioners, cleaning products, personal care products, health care products (inc. all mammalian health care products). The invention further provides use of a flavor compound according to the invention as a lengthening agent and fixative in perfumes or as a suspension aid for aluminium salts in anti-perspirants pharmaceuticals (e.g. deodorants). The invention provides use of a nucleic acid according to the invention as a molecular marker or diagnostic tool. Preferably as a molecular marker for flavor formation [for example nerolidol and /or linalool and/or a-pinene and/or 13-pinene (bicyclic terpene hydrocarbons) and/or sabinene and/or !3-myrcene (acyclic monoterpene) and/or a-phellandrene and/or !3-phellandrene and/or a terpinolene and/or a-terpineol and/or ~y-terpinene production] in plant breeding. Even more preferred as a molecular marker for fruit ripening (for example fruit ripening of strawberry and grapefruit). The nucleic acid according to the invention can be used as markers for the selection of crop species, such as for example maize, cotton, apple, and cucumber, and any other crops employing a volatile release defense mechanism, with improved production of volatile terpenoids (e.g. a predator attracting flavor (terpenoid) compound according to the invention) in response to feeding pests.The invention further provides use of a flavor and/or bio-control compound according to the invention in the preparation of a composition. Suitable basis for compositions are known in the art. Preferably said composition comprises at least nerolidol and/or linalool and/or a-pinene and/or 13-pinene and/or sabinene and/or 13-myrcene and/or a-phellandrene andlor 13-phellandrene and/or a-terpinolene and/or a-terpineol and/or y-terpinene, or mixtures thereof. The invention further provides a composition comprising a flavor and/or bio-control compound according to the invention. Preferably said compositions are anti-fungal, miticidal, or pesticidal. For example a miticidal composition is usefel for controlling spider mite populations. Preferably said compositions comprise slow-release formulations which can be employed for fumigation purposes. For example fumigation in agriculture for the protection of crops against micro-organisms and pests e.g. insects, mites etc. Preferably said composition is in a form that can be administered to a plant, animal (including human), food or non-food product, industrial product etc. The invention provides a composition comprising a flavor and/or bio-control compound according to the invention which is a pharmaceutical. Suitable pharmaceutical compositions are known and they may be in dosage forms such as tablets, pills, powders, suspensions, capsules, suppositories, injection preparations, ointments, eye drops etc. The invention provides a composition comprising a flavor ancUor bio-control compound according to the invention which is a neutraceutical.The invention provides for use of a composition comprising a flavor and/or bio-control compound according to the invention for augmenting or enhancing the aroma and/or taste of food or non food products and/or protection of food or non food products against fungal contamination and/or pest infestation. For example chewing gums, medicinal products, detergents, cosmetics, confectionery etc. Preferably said composition will enhance the shelf life/preservation of food and non-food products (inc. industrial products).The invention provides for use of a composition comprising a flavor and/or bio-control compound according to the invention for the biological control of pests. For example administrating said composition to a plant. Modes of administration can readily be determined by conventional protocols and may take the form of sprays, dissoluble pellets etc.The invention provides for use of a composition comprising a flavor and/or bio-control compound according to the invention far the protection of stored products. For example for the protection of stored products against micro-organisms, insects and other pests. For example the protection of potatoes, flowerbulbs, onions etc. against Phytophtora spp, Phoma spp, Fusarium, Botrytas spp and other stored product pathogens.The invention provides for use of a composition comprising a flavor and/or bio-control compound according to the invention for the prevention or treatment of disease. For example for the treatment of dental caries and/or dental plaque and/or skin disorders (dermatological formulations) and/or immunosuppressive, anti-leukaemia and anti-retroviral treatment. A preferred embodiment is that said composition is suitable for human consumption or external application. The invention provides for a method of treatment of disease comprising administering a composition according to the invention with a carrier to a suitable recipient. Preferably said carrier is a pharmaceutically acceptable carrier (e.g. drug carrier system) or inert carrier, such as a glycoside. Brief Description of the Drawings:Figure 1: Headspace analysis using GC-MS of wild (A) and cultivated strawberry (B). Chromatograms are of m/z 93 (obtained in SCAN mode). Peaks:1, a-pinene; 2, !3-myrcene; 3, I3-phellandrene; 4, y-terpinene (tentative); 5, a-terpinolene (tentative); 6, a-terpineol; 7, carvylacetate; S, linalool; 9, traps-nerolidol. Figure 2: Sequence alignment of H64 proteins H64NORS, H64MUT, H64VES.H64MUT nucleic acid sequence after the stop codon in H64NORL (location marked) was changed into a Leucine residue. Black background corresponds to identical residues in all three sequences and gray background corresponds to identity between two out of the three sequences. Figure 3: targeting signals in the different H64 genes.A. Protein sequence alignment of the different H64 fragments obtained by PCR on genomic DNA and the same regions in cDNAs isolated. Arrows indicate which one of the sequences do not have a stop codon in this region. The RR motif is common in targeting signals of monoterpene synthases. Black background corresponds to identical residues in all seven sequences and gray background corresponds to identity between at least three out of the seven sequences. B. Site directed mutagenesis and constructing H64MUT from H64NORL. The 5'region of H64NORL and H64MUT is aligned between the two ATG codons and the position of directed mutagenesis is marked by the gray background. The stop codon T(U)GA in H64NORL was converted to a codon encoding a leucine residue (CTA). Figure 4: Expression of H64 genes analyzed by RNA gel blots and H64NORL cDNAas a probe.A. Expression in vegetative (leaves) and reproductive (4 stages of fruit development) tissues. B. Expression in ripe fruit of two wild cultivars (1, Plant Research International line H1 and 2 Plant Research International line 92189) and two cultivated cultivars (1, cultivar Calypso and 2, cultivar Gorrella.C. Expression in fruits treated with or without the synthetic auxin NAA. Strawberry fruit (cultivar Elsanta) at the white stage of development were treated with lanolin paste containing 100mM NAA. Treated and control berries (paste with no NAA) were treated, left on the vine for 7 days and then picked and used for RNAisolation.Figure 5: The pRSET B expression vector used for cloning and expression of H64MLTT/, SOSA and SOSV in E.Coli cells.Figure 6: Nucleic acid sequence alignment of the two cultivated SOSA cDNAs cloned (MA and WS) and their homolog from the wild strawberry (SOSV). Black background 1~ corresponds to identical residues in all three sequences and gray background corresponds to identity between two. out of the three sequences. The location of the CC insertion causing the frame shift and the stop codon following it is depicted. The stop codon at the 3' is the end of the ORF.Figure 7: Alignment of the protein sequence of the different SOS cDNAs isolated.Black background corresponds to identical residues in all five sequences and gray background corresponds to identity between at least three out of the five sequences.The insertion of CC in SE~11B(SOSA/MA) and SEQ10B(SOSA/WS) forms a proline residue and a stop codon after. In SEQ11C(SOSA/MA) and SEQ10C(SOSA/WS) the two cytosine nucleotides were removed and allowed further translation of the protein.Figure 8: Nucleic acid sequence alignment of the different SOS fragments obtained by PCR on genomic DNA and the same regions in cDNAs isolated from wild and cultivated strawberry. The source of the fragment is marked in the left side of each sequence name. Black background corresponds to identical residues in all fifteen sequences and gray background corresponds to identity between at least twelve out of the fifteen sequences. Figure 9: Expression of SOS genes analyzed by RNA gel blots and SOSV cDNA as a probe Expression in ripe fruit of two wild cultivars (1, Plant Research International line H1 and 2 Plant Research International line 92189) and two cultivated cultivars (1, cultivar Calypso and 2, cultivar Gorrella.Figure 10: Radio-GLC analysis of radio-labelled products formed from [3H]-geranyl diphosphate in assays with recombinant proteins. A, FID signal showing unlabelled authentic standards of 1, I3-myrcene; 2, t~~ans-ocimene; 3, linalool; 4, a-terpineol; 5, nerol; 6, geraniol. B,C, radio-traces showing enzymatic products of recombinant proteins SOSV (B) and H64MUT (C).Figure 11: Radio-GLC analysis of radio-labelled products-formed from [3H]-farnesyl diphosphate in assays with recombinant protein. A, FID signal showing unlabelled authentic standards of 7, cis-nerolidol; 8, traps-nerolidol; 9, traps-traps-farnesol. B, radio-trace showing enzymatic products of recombinant protein H64MUT. Figure 12: GC-MS analysis on an HP5-MS column of products formed from geranyl diphosphate in assays with recombinant SOSV protein. Peaks: 1, a-pinene; 2, !3-pinene; 3, sabinene; 4, I3-myrcene; 5, a-phellandrene; 6, I3-phellandrene; 7, dihydromyrcenol (tentative); 8, a-terpinolene (tentative); 9, a-terpineol (tentative).Figure 13: GC-MS analysis on an HP5-MS column of the product formed from geranyl diphosphate in an assay with recombinant H64MUT protein. A, m/z 93 chromatogram. B, mass spectrum of the major product peak (linalool). Figure 14: GC-MS analysis on an HP5-MS column of the product formed from farnesyl diphosphate in an assay with recombinant H64MUT protein. A, m/z 93 chromatogram. B, mass spectrum of the major product peak (nerolidol). Figure 15: Transient GFP expression of fusion proteins in tobacco protoplasts. g, GFP; ca, chlorophyll auto-fluorescence; mt, MitoTracker (mitochondrial stain); o1, overlay of chlorophyll auto-fluorescence image and GFP image; ol-mt, overlay of chlorophyll auto-fluorescence image, GFP image and Mitotracker image. 10 different constructs were made (C1-C10) to study fragments derived from H64NORL (C1, C2), H64TAR4 (C3, C4, C5) and H64VES (C'7, C8, C9). See Figure 16 for a schematic representation of the different constructs made and used for the localization studies.C6 shows localization of fusion of a citrus limonene synthase 5' end with GFP. C10 is a fusion of the H64VES region between the two Methionine residues and the region down stream of the second Methionine from H64NORL. pOL65 is the original vector, containing only GFP and was used to insert all fragments for fusion with the GFP.Rpo-of is a positive control for plastidic targeting signal. Chloroplasts are on average 5 micrometer in size while mitochondria are 1 micrometer in size. pOL65, C1, C2, C4, C5, C8 and C9 all show cytosolic localization. C3 shows dual plastidic and mitochondrial localization. C6, C7, C10 and Rpo-of show plastidic sub-cellular localization. Figure 16: Schematic representation of the different constructs used for GFPtransient expression assays in tobacco protoplasts. Fagments derived from the 5'-end of the cDNAs described in the invention were used for a translational fusion with the GFP gene. The MID motif is present in most sesquiterpene synthase genes described up to date. SC, stop codon. M1 and M2 are the two methionine residues at the N-termini of the various proteins (see also Figure 3A).Figure 17: Comparison of effects of farnesol and linalool present in the growth medium on mycelium growth of Phytophthora infestans.Figure 18: Dose-response data of effects of linalool present in the growth medium or the vapour phase on mycelium growth of Phytophthora infestarcs.Figure 19: Dose-response data of effects of nerolidol present in the growth medium or the vapour phase on mycelium growth of Pltytophthora infestans. Figure 20: Dose-response data of effects of linalool and nerolidol present in the growth medium alone and in combination on mycelium growth of Phytophthora infestans. Figure 21: Dose-response data of effects of linalool and nerolidol present in the growth medium alone and in combination on mycelium growth of Phytophthora infestans.10 Figure 22 Dose-response data of effects of linalool and nerolidol present in the growth medium on mycelium growth of Fusarium spp. on day 7. Figure 23 15 Dose-response data of effects of linalool and nerolidol present in the growth medium on mycelium growth of Botrytis spp. on day 7. Figure 24 Dose-response data of effects of nerolidol (A) and linalool (B) present in the growth 20 medium on spore germination of Fusariurn uertvcillioides isolates on day 3. Figure 25 Headspace analysis of transgenic Arabidopsis expressing the H64NORS with the H64VES targeting signal (H64TAR) cDNA, showing a large peak of linalool (1), and a 25 smaller peak of nerolidol (2). Both compounds are absent in control, wildtype Arabidopsis (see insert). Figure 26 Headspace analysis of volatiles produced by control and transgenic, H64TAR30 expressing, potato (3 individual transformants TM 9, TM 13, TM 29). Linalool is virtually absent in control potato, and strongly enhanced in the transgenic lines. Also ~-hydroxylinalool is enhanced in the transgenic lines. Figure 27 Chiral analysis of the free linalool in control and transgenic potato, showing the presence of both enantiomers in control potato (about 80:20). In the H64TARtrangenic lines the ratio has shifted drammatically to the S-enantiomer, that is produced by the introduced enzyme. Figure 28ATdentification of linalyl-13-D-glucopyranoside in Petunia tissue using HPLC-MS/MS.Ion trace m/z 375 of A: the synthesized (R,S)-linalyl-!3-D-glucopyranoside, B: the transgenic Petunia leaf tissue and C: The control Petunia leaf tissue. Figure 28BProduct ion spectrum of A: The synthesized (R,S)-linalyl-!3-D-glucopyranoside and B: The compound isolated from the transgenic Petunia tissue. Retention time and product ion spectrum of the synthesized (R,S)-linalyl-f3-D-glucopyranoside fit with. the compound detected in the transgenic Petunia tissue. Figure 29 Determination of the enantiomeric distribution of S- and R-linalool after enzymatic hydrolysis of the glucoside fraction obtained from leaf tissue using chiral phase MDGC-MS analysis, A: Control tissue and B: the transgenic tissue. The transgenic plant accumulates highly enriched S-linalyl-I3-D-glucopyranoside. Figure 30 Figure 30 combines the data of table 1 and 4. Figures 30 A, B and C provide the correlation in lesion size, lesion growth rate, and sporulation respectively of Pfaytophthora anfestans isolate IPO 428-2 plotted against the content of linalool, 8 hydroxylinalool, linalooltriol, lynalylglucoside, 8-hydroxylinalylglucoside and linalyltriolglucoside content of the potato transgenic lines T or TM-9, -13, -29 and a control line. The control data from table 4 on fungal growth and sporulation were taken to be the average values of the H64NOR plants with negligible increased levels of either linalool, nerolidol or derivatives. The linalool (derivative) data provided in table 1 are much more reliable and quantitative than the SPME data on linalool in table 4, which justifies their use. Figure 30 D provides the an vitro data on the sensitivity of Phytophthora infestans isolate IP0428-2 which was used for the in planta experiments to pure linalool in the medium as described in Example 9. Examples The following examples are offered by way of illustration. Example 1. Analysis of terpenes in wild and cultivated strawberry Terpenoid Biosynthesis in Wild and Cultivated Strawberries The cultivated variety (Elsanta) used by us for the mentioned experiments produces both the monoterpene linalool and the sesquiterpene nerolidol. On the other hand the wild cultivar used (PRI line 92189) produces low levels of linalool but does not show a trace of nerolidol. Both literature reports and our own GC-MS data show similar patterns of linalool and nerolidol production in several other cultivated and wild strawberry varieties. Our sequencing data and experiments using the recombinant enzymes produced in E.colv show that the capability of the cultivated variety to form nerolidol was acquired by removing (by deletions and translation stop) the targeting signal to the plastid [were the substrate for monoterpene biosynthesis is available (GPP)] and by directing the translation start to the downstream AUG codon.However, linalool in the cultivated varieties may also be formed by enzymes encoded by genes similar to H64TAR2, H64TAR4 and H64TAR6 which contain a proper targeting signal with no stop and therefore their protein products are directed to the plastid for forming linalool. If GPP is present in the cytosol, then linalool could also be produced there by an enzyme encoded by a cytosolically expressed cDNA. We can not exclude that translation in H64TAR2, H64TAR4 and H64TAR6 may also start from the downstream AUG codon (the one downstream from the RR motif and not the additional AUG codon present just prior the RR motif) and this will result in the formation of nerolidol as well. However, since cultivated varieties like the ones used in this study are mostly octaploids it is likely that evolutionary processes as polyploidity allows the plant to form an additional (mutated) gene from an existing gene and to produce an additional beneficial compound such as nerolidol for flavour and defense. Williams et al., (Biochemistry 1998,37,12213-12220) described a role for the tandem arginines present in the N-terminal of monoterpene synthases in the unique diphosphate migration step accompanying formation of the intermediate 3-s-linalyl diphosphate and preceding the final cyclization reaction catalyses by the monoterpene synthases. This RR motif is present in H64TAR2, H64TAR6, and H64VES and this might explain the formation of linalool by this genes encoding enzymes. However, the H64MUT recombinant protein does not contain the RR motif but catalyses the formation of both nerolidol and linalool. This might implicate other residues between the RR motif location and the down stream AUG as functioning to determine whether monoterpene will be formed. This motif contain 12 amino acids: N-termini- DSLLPSSITII~P.The short genomic DNA sequence obtained (H64W149) contains an RW motif instead of an RR motif and it might be of importance for the formation of the monoterpene linalool. In the wild cultivars (diploid) only one variant encoding a protein with a targeting signal could be identified (both by PCR on either DNA and RNA) which may only catalyze the formation of the low levels of linalool detected.Headspace analyses. Samples of ripe or ripening fruits were enclosed in 1-L glass jars that were closed with a teflon-lined lid equipped with an in- and outlet, and placed in a climate room at 25°C and 210 ~,mol.m-~.s-1 provided by 400-W HPI-T lights (Philips, Eindhoven, the Netherlands). A vacuum pump was used to draw of air through the glass jars at approximately 100 mL min-1, with the incoming air being purified through a glass cartridge (140 x 4 mm) containing 150 mg Tenax TA (20135 mesh, Alltech, Breda, the Netherlands). At the outlet the volatiles emitted by the fruits were trapped on a similar Tenax cartridge. Volatiles were sampled during 24 h.Cartridges were eluted using 3 x 1 mL of redistilled pentane-diethyl ether (4:1). Of the (non-concentrated) samples, 2 ~L were analysed by GC-MS using an HP 5890 series II gas chromatograph equipped with an HP-5MS column (30 m x 0.25 mm i.d., 0.25 ~m dfj and an HP 5972A Mass Selective Detector. The GC was programmed at an initial temperature of 45°C for 1 min, with a ramp of 10° min-1 to 280°C and final time of 5 min. The injection port (splitless mode), interface and MS source temperatures were 250, 290 and 180°C, respectively, and the He inlet pressure was controlled by electronic pressure control to achieve a constant column flow of 1.0 mL min-1. Ionization potential was set at 70 eV, and scanning was performed from amu. The analysis of the headspace profiles was focused on terpenoids by only showing the ion 93 chromatogram (although samples were analysed using the SCAN5 mode). In that way, remarkable differences can be seen between cultivated and wild strawberry: the headspace profile of the wild strawberry contains carvylacetate and a number of olefinic monoterpenes such as a-pinene, myrcene, a-phellandrene, and a-terpinolene, a-terpineol and ~-terpinene (the last three tentatively identified) (Figure 1A), whereas the cultivated is dominated by two major peaks only: linalool and trans-10 nerolidol (Figure 1B). Example 2. General Molecular Techniques DNA was isolated from young strawberry leaves as described by Marty et al., [Theor.15 Appl. Genet. (2000) 100:1129-1136].RNA gel blots experiments were performed as described by Aharoni et al., [The Plant Cell, (2000) 12, 647-661]. Cloning full length cDNAs was performed by using the SMART RACE cDNAAmplification Kit (Clontech) according to the manufacturer instructions with slight 20 modifications either to annealing temperatures (normally reduced by 5 to 10°Ccompared to the one recommended) or amount of cycles (up to 35 cycles). PCR, restriction digests, plasmid DNA isolation and gel electrophoresis were performed using standard protocols. All fragments were purified out of gel using the GFX purification kit (Amersham). Cloning of PCR fragments was either done to the 25 PCR SCRTPT (Stratagene) or pCR 4Blunt-TOPO (Invitrogen) vectors (for blunt end products generated when using pfu polymerase) or to the pGEM-T Easy (Promega) vector (when A tailed PCR products were generated by the use of taq polymerase). Throughout the text the following construct/cDNA names will be used (also see sequence listing):30 - H64VES: wild strawberry, full length cDNA (with targeting signal) H64NORL: original cultivated strawberry cDNA starting from Met 1, including stopcodon between Met 1 and Met 2 (non-functional targeting signal) - HG4NORS: derived from H64NORL starting from Met 2 (no targeting signal) - H64MUT: derived from H64NORL; stopcodon repaired - H64TAR: used for transformation of plants: composed of HG4VES Met1 to Met 2 region and H64NORS (with targeting signal) - H64NOR: used for transformation of plants: H64NORS including intron Example 3. Construction of a Strawberry Red Fruit Stage cDNA Library, Mass Excision and Random Sequencing Messenger RNA Isolation and cDNA Library Construction Total RNA was isolated from strawberry fruit red stage of development using the method described by Manning K. [Analytical Biochemistry (1991) 195, 45-50]. The cultivar used was Fragaria X ananassa Duch. cu. Elsanta. The cDNA library was produced as a custom service by (Stratagene) in the lambda zap vector. Messenger RNA was isolated from total RNA using the polyA+ isolation kit (Pharmacia). Mass Excision and Random Sequencvng The ExAssistTM/SOLRTM system (Stratagene) was used for mass excision of the pBluescript SK(-) phagemid. The excision was done according to the manufacturer instructions using 20 x 103 pfu from the non-amplified library for each excision. High quality plasmid DNA from randomly picked colonies was extracted using the (s,IIAGEN BioROBOT 9600. Colonies were grown overnight in 3m1 Luria Broth medium (10g11 tryptone, 5 g/1 yeast extract, 5 g/1 NaCl) supplemented with 100 mg/1 ampicillin, centrifuged at 3000 RPM for 10 min. and the pellet was used directly for plasmid DNA isolation by the robot. Each DNA isolation round consisted of 96 cultures.Insert size was estimated by agarose gel electrophoresis after restriction enzyme digestion of the pBlueScript (SK-) vector with EcoRI and XhoZ Inserts with length above 500 by were used for sequencing. Plasmid DNA from the selected samples were used for polymerase chain reaction (PCR) sequencing reactions using the ABI PRISMTM Dye Terminator Cycle Sequencing Ready Reaction Kit and the MJ Research PTC-200 DNA EngineTM thermal cycler. The T3 and T7 universal primers were used for sequencing from the 5' and 3'ends respectively. PCR program was according to the Dye Terminator manufacture's protocol (ABI PRISM). The ABI 373, 370A and 310 sequencers (Applied Bio-systems) were used. Sequences were edited manually to remove vector and non reliable sequences and submitted to the BLASThomology search (Altschul et al. J. Mol. Biol. 215, 403 - 410, 1990) provided by the National Center for Biotechnological Information on the world wide web (infoC~ncbi.nlm.nih.~,ov). Search was performed against all non-redundant data bases available by the program. Example 4. Cloning and Characterization of H64 Genes from Wild and Cultivated Strawberry Cloning of the H64 cDNA from Cultivated Strawberry (H64NORL) and its Homologue from the Wild Strawberry (H64VES) We primarily identified the HG4 cDNA out of our randomly sequenced clones originating from the cultivated strawberry cultivar Elsanta (ripe red fruit) cDNAlibrary. Homology search results using the BLAST program indicated that the cDNAmight encode a terpene synthase protein. The entire H64 cDNA is 1874 by long [(termed H64 Normal Long (H64NORL)] and contains a open reading frame (ORF) encoding a 519 amino acids (aa) long protein [we termed the part of the cDNAforming the 519 as ORF as H64 Normal Short (H64NORS), see Figure 2]. Cloning of the wild strawberry homolog of the cultivated HG4 cDNA was accomplished by the use of the SMART RACE kit (Clontech) using RNA from the Plant Research International collection of wild strawberries (line 92189).Oligonucleotides primarily used for sequencing the H64NORL cDNA were used for 3' RACE amplification (AAP291 - 5'- CTTCATGAGGTTGCACTTCG- 3' and the nested oligonucleotide AAP 293 - 5'- AATGGTGGAAGGAGCTTGGATTGG- 3'). The full length wild strawberry cDNA [H64 Vesca (HG4VES)] was obtained by designing an oligonucleotide on the 3' untranslated region (UTR) based on the 1000 by fragment obtained, in the 3' RACE and using it to RACE for the 5' side (5' GTTCAACTCCACTTCCAGCAGTC 3'). The H64VES cDNA is 1894 by long and contains a open reading frame encoding a 580 amino acids (aa) long protein. Sixty 3~one amino acids downstream of the first methionine residue of the 580 as protein we could identify an additional methionine residue. This 61 amino acids resemble the characteristic plastidic targeting signal of monoterpene synthases since it contains the two arginines motif and a large number of serine residues [Williams et al.(Biochemistry, 37 12213-12220, 1998); see Figure 3A). The H64NORL and H64VEScDNAs share 96 % identity at the nucleic acid level and if the stop codon is eliminated and the rest of the sequence translated, 92.4 % at the amino acid level (from the ATG located at nucleotide 145 up to the end of the coding region). and H64NORS share 97.2 % identity at the nucleic acid level and 94.2 % at the amino acid level (when the part starting from the beginning of H64NORS from H64NORVES is used for the alignment up to the end of the coding region).Analysis of H64 Expression During Development, in Cultivated and Wild Cultivars and in Response to Auxin Treatment RNA gel blot analysis using H64NORL as a probe revealed that it is upregulated during the cultivated strawberry fruit ripening (Figure 4). No expression could be detected in the leaf and green fruit tissues. H64 expression increased from the white to red stage of fruit development. Analysis of H64 expression in ripe fruits of two wild and two cultivated cultivars showed that H64 is strongly expressed in the cultivated cultivars and hardly any expression could be detected in the wild cultivars (slight signal was detected in the wild cultivars after long exposure of the film, data not shown). Another RNA gel blot showed that H64 is repressed by auxin. This correlates with the fact that also other ripening up-regulated genes in strawberry are repressed by auxin. Site Directed lllutagenesis of H64NORLA more thorough analysis of the H64 cDNA (termed H64NORL) revealed that it might contain an additional ATG start codon, 99 by upstream of the original ATG we identified (proposed to be the beginning of the ORF encoding the 519 as protein). The two ATG codons were located in frame but no peptide could be formed between them since a stop codon located 39 by before the down stream ATG was evident. We suspected that the part between the two ATG is actually part of the protein and for some reason it might be mutated so a shorter protein starting for the downstream ATG might be formed. Additional support to this idea was the high abundance of serine residues identified in the translated area between the two ATGs.It resembled N-termini of other monoterpenoid synthases which contain relatively high abundance of serine residues. We therefore employed site directed mutagenesis in order to modify the stop codon and construct a non truncated H64NORL protein [termed H64 Mutagenized (H64MUT)]. By changing the stop codon (TGA) into a leucine residue (CTA) the H64MUT cDNA is 1659 by long containing a 552 as long protein (see Figure 3B). The site directed mutagenesis was performed using the QuikChange kit as described by the manufacturer (Stratagene). The oligonucleotide used for the exchange was, 5'- GGGAAGCAAGCTATCTAGAAAGTAGCAG-GCAATT-3'. PCR on Cultivated Strawberry Genomic 1)NA In order to verify whether the sequence we obtained for H64NORL was not a PCRartifact and the stop codon between the two ATGs exists, we performed PCR on the cultivated strawberry genomic DNA. We designed two oligonucleotides one upstream the first ATG (5'- CTCCCACAGCTTCTTAGTTGC- 3') and the other downstream of the second ATG (the beginning of H64NORS) (5'-CTAGCTCTGCTACATTCCTCAAGAC- 3'). Amplification with these two oligonucleotides was expected to amplify a fragment of approximately 200 bp. We obtained two clear fragments of 300 by and 400 by each. Sequencing four clones of the 300 by length fragments revealed them to be similar to the original cDNA. Sequencing and aligning 20 of the larger clones identified several isoforms which were different from the original cultivated H64NORL cDNA. All fragments (including the short ones) contained an intron of approximately 100 bp. Four unique different clones out of the 20 sequenced were identified. Two of them [SEQ6C(H64NORU1/W151) and SEQ7C(H64NORU2/UP3)] had an additional 20 as (compared to H64MUT) but still contained a stop codon located immediately at the beginning of the peptide they formed. Other two fragments [SEQBC(H64NORU3/ITP16) and SEQ9C(H64NORU4/UPl)] did not contain any stop codon and were most similar to the sequence of H64VES. These fragments added as to the H64MUT sequence and they both contain the two arginine residues as in H64VES which are most often found in the plastidic targeting signal of monoterpene synthases (see Figure 3A).5 Clonang H64MUTlH64NORS for Expression in E.coli The E.coli expression vector pRSETB (Invitrogen) was used for heterologous expression of strawberry terpene synthases (see Figure 5). The pRSETB vector contains the T7 promoter which can be induced by isopropyl-(3-D-thiogalactopyranoside (IPTG) and therefore by inserting the desired gene 10 downstream of this promoter, the gene can be expressed in E. coli. In addition, DNAinserts were positioned downstream and in frame with a sequence that encodes an N-terminal fusion peptide. This sequence includes (in 5' to 3' order from the N-terminal to C-terminal), an ATG translation initiation codon, a series of six histidine residues that function as a metal binding domain in the translated protein, the Anti-Xpress 1b epitope, and the enterokinase cleavage recognition sequence. The original pRSETB was primarily used for the insertion of the gene encoding the Green Fluorescent Protein (GFP). The GFP gene was fused to the pRSETB vector using the BamHI and HindIII restriction sites located at the multiple cloning site (MCS) as can be seen in figure 5. This construct for the expression of GFP20 served as control for the experiments together with the empty pRSETB vector. Cloning the GFP gene to the pRSETB vector inserted an additional SaIIrestriction site at the 3' of the GFP gene and together with the BamHI site located at the 5' of the GFP gene served as sites for cloning H64MUT. The BamHI and SaIIsites were introduced to the 5' and 3' respectively of the H64MUT coding sequence by 2~ the use of PCR. The 552 amino acid open reading frame of the H64MUT clone was amplified with the pfu DNA polymerase (Stratagene) and oligonucleotides (containing the BamHI and SaII sites) AAP339 (5'- CGGATCCGGCATC-GTCTTCTCGGGC- 3') and AAP334 (5'- CGTCGACCAACTCCACTTCCGGTAGTC- 3') according to the manufacturers instructions. The PCR product was cloned into PCR-script vector 30 (Stratagene), cut out with BamHI and SaII and further inserted (as a translation fusion) into the corresponding restriction sites in the pRSETB vector. H64NORS was cloned in a similar way. Bacterial Expression and Partial Purification using the His tag Columns.The pRSETB vector harboring the H64MUT or H64NORS was used to transform E.coli strain BL21 Gold DE3 pLysE (Stratagene) as described by the manufacturer. For bacterial expression typically 1 ml of overnight liquid culture grown at 37 ° C in Luria Broth (LB) medium (10g/1 tryptone, 5 g/1 yeast extract, 5 g!1 NaCl) supplemented with 100 mg/1 ampicillin was diluted 50 times in the same medium and grown until the ODsoo reached 0.4 (at 37° C). At this stage IPTG was added to a final concentration of 1mM in order to induce expression . After overnight growth at 16°C the cells were harvested by centrifugation at 4000 x g for 15 min. Pellet and a sample from the supernatant were kept for SDS gel analysis. The cells were further processed as described by the Ni-NTA Spin Columns manufacturers (~IAGEN) for protein purification under native conditions. First elute from the column (200 ~l) was further used for enzymatic activity assays. Example 5. Cloning and Characterization of SOS Genes from Wild and Cultivated Stravcyberry Cloning of the SOS cDNA from Cultivated Strawberry (SOSA) and its homolog from the Wild Strawberry (SOST~ For cloning the SOSA(MA) cDNA from the cultivated strawberry CV Elsanta, we designed an oligonucleotide on a published sequence of a sesquiterpene cyclase from the wild strawberry (Nam et al. Plant Mol. Biol. 39: 629-636, 1999). The oligonucleotide (AAP 272, 5'- GATGATATGTATGATGCATTCGG- 3') was used to perform a 3' RACE reaction using the RACE kit (Clontech) and a 991 by fragment was cloned. For cloning the full length cDNA we performed a 5' RACE reaction using an oligonucleotide designed on the 3' UTR of the cDNA (AAP283, 5'-GAAAGGATAGGCTCATCAGTACGTG- 3'). The entire SOSA(MA) cDNA cloned is 2605 by long. We however could not identify an ORF encoding a protein longer then 255 aa, which is less then a half of a typical terpene synthase. Therefor a second attempt to clone a cDNA with a longer ORF was performed. Using oligonucleotides based on the SOSA(MA) sequence, one located on the beginning of the ORF (AAP325, 5'- CGGATCCGCCTGTCCATGCTACTCC- 3') and the other on the UTR (AAP341, 5'-CGTCGACTGAGTTCAGAGTGGCACTGG- 3'), a second full-length SOSA cDNA was isolated by the means of PCR on the cultivated strawberry cDNA [termed SOSA(WS)]. Sequencing SOSA(WS) revealed that as for SOSA(MA) it contains a truncated ORF. We decided to clone the full length SOS homolog from the wild strawberry in order to identify the cause for such a truncation in the cultivated genes ORF. Cloning of the wild SOS homolog was performed by 3' RACE reaction using an oligonucleotide designed on the SOSA(MA) ORF (AAP325, see above). The full length SOS homolog from the wild strawberry (SOSV) is 1973 by long and contains a ORFencoding a 556 as long protein. Aligning SOSA(MA), SOSA(WS) and SOSV nucleic acid sequences revealed minor changes in the ORF (see Figure 6). We could however identify the basis of the truncation in the cultivated SOS genes which was an insertion of two cytosine nucleotides causing a frame shift followed by a stop codon (see Figure 6). Removing the CC insertion from the SOSA(WS) and SOSA(MA) genes results in the formation of ORFs encoding 554 and 555 as respectively (Figure 7). PCR on C'ultiuated and Wild Strawberry Genomic DNAIn order to confirm the presence of the CC frame shift, causing a truncation in the cultivated strawberry SOS genes we analyzed the existence of the insertion at the DNA level. PCR on both wild and cultivated strawberry genomic DNA was performed using two oligonucleotides located from both sides of the place of insertion (AAP345, 5'- AGAGGTTAGGTGCTCGGCGTTAC- 3') and the reverse oligonucleotide, AAP346, 5' GAACAACTCCACGATCCTATCTC- 3'). The expected amplified DNA fragment was 200 bp. PCR products at the size of 300 by were obtained from both reactions using the wild and cultivated DNA. We sequenced 20 and 15 fragments from the cultivated and wild strawberry reactions respectively. All fragments contained an intron of approximately 100 bp. Sequence alignment of all fragments revealed 7 different sequences from the cultivated and 5 from the wild. Figure ~ shows an alignment of all fragments of the SOS genes both from the wild and cultivated strawberry obtained either from RNA (the different cDNAs) or from DNA. Among the cultivated fragments we could identify 2 fragments which showed the CC insertion while the other 5 did not contain it. On the other hand no fragment in the wild strawberry could be detected that contained the frame shift mutation. Analysas of SOS Expression in Ripe Cultivated and Wild Strawberry Fruit Using the SOSV cDNA as a probe we analyzed SOS gene expression in two different wild and cultivated cultivars (Figure 9). The SOSV cDNA could be used for hybridization with blots containing RNA from both wild and cultivated cultivars since the SOSA genes and SOSV share nearly 99 % identity at the nucleic acid level (in the ORF region). Hardly any expression could be detected in the cultivated cultivars while strong expression could be detected in the wild cultivars. The SOSA probe was also used for hybridizing blots with RNA extracted from different cultivated (Elsanta) fruit developmental stages, but just weak signal could be detected after long exposure. Nam et al., (1999) were also not able to detect expression of the partial cDNA homolog of SOS with RNA derived from different fruit developmental stages of the cultivated strawberry. Expression in different wild strawberry plant tissues was restricted to the fruit, specifically to the red ripe stage. Cloning and Expression of SOSV and SOSA in E.coli Both the SOSA and SOSV coding regions were used for the formation of a recombinant protein in E.Coli cells. The entire ORF of SOSA cDNA although truncated was expressed in order to serve as a negative control for the enzymatic assays. Similar to the cloning of H64MUT the BamHI and Sall restriction sites at the 5' and 3'of the GFP gene respectively served as sites for the cloning of SOSA and SOSV ORFs into the pRSETB expression vector. The BamHI and SaII sites were introduced to the 5' and 3' respectively of the wild and cultivated SOS genes coding sequence by the use of PCR. The restriction sites were added to the oligonucleotides used for PCR reaction (AAP325, 5'- CGGATCCGCCTGTCCATGCTACTCC- 3' and the reverse primer AAP341, 5'- CGTCGACTGAGTTCAGAGTGGCACTGG- 3'). The PCRproduct was cloned into PCR-script vector (Stratagene), cut out with BamHI and SaIIand further inserted (as a translation fusion) into the corresponding restriction sites in the pRSETB vector. Expression of SOSA and SOSV in E. Cola was performed parallel to the expression of H64MUT and under identical experimental conditions. Example 6. Analysis of SOSA, SOSV, H64MUT and H64NORS recombinant enzymes For determination of terpene synthase identity, the His-tag purified enzymes (prepared as described above under Example 4.6) were diluted 10-fold with buffer Acontaining 15 mM MOPSO (pH 7.0), 10% glycerol, 10 mM MgClz, 1 mM sodium ascorbate and 2 mM DTT. To 1 mL of this enzyme preparation, 40 ~M of either [3H]-geranyl diphosphate (GPP) or [3H]-farnesyl diphosphate (FPP) were added. Assays with GPP as substrate were also supplemented with 1 mM MnCh. After the addition of a 1-mL redistilled pentane overlay, the tubes were carefully mixed and incubated for 1 h at 30°C. After the assay, the tubes were vortexed, the pentane layer was removed and passed over a short column of aluminum oxide overlaid with anhydrous NaaS04. The assay was re-extracted with 1 mL of diethyl ether, which was also passed over the aluminum oxide column, and the column washed with 1.5 mL of diethyl ether. 100 ~L of the organic exrtract was removed for liquid-scintillation counting in 4.5 mL of scintillation cocktail (Ultima Gold, Packard Bioscience, The Netherlands). Radio-labelled products were present in the organic extracts of: [3H]-GPP + + + -[3H] -FPP + + _ _ Subsequently, the extracts were carefully concentrated under a stream of N2 before analysis using radio-GLC and GC-MS. Radio-GLC was performed on a Carlo-Erba 4160 Series gas chromatograph equipped with a RAGA-90 radioactivity detector (Raytest, Straubenhardt, Germany). Sample components eluting from the column were quantitatively reduced before radioactivity measurement by passage through a conversion reactor filled with platinum chips at 300°C. Samples of 1 ~L were injected in the cold on-column mode. The column was a fused silica capillary (30 m x 0.32 mm i:d.) coated with a film of 0.25 wm of polyethylene glycol (EconoCap EC-WAX, Alltech Associates) and operated with a He-flow of 1.2 mL min-1. The oven temperature was programmed to 70°C for 1 min, followed by a ramp of 5° min-1 to 210°C and a final time of 10 min. About 20% of the column effluent was split with an adjustable sputter to an FID (temperature 270°C). The remainder was directed to the conversion reactor and radio detector. H2 was added prior to the reactor at 3 mL min-1, and CH4 as a 5 quench gas prior to the radioactivity detector (5 mL counting tube) to give a total flow of 36 mL min-1. Radio-GLC analysis gave the following results:- the SOSV and H64MUT and HG4NORS recombinant proteins catalysed the formation of radio-labelled products from [3H]-GPP (Fig 10). For the SOSV protein a number of radio-labelled product peaks were visible in the retention time area of 10 olefinic monoterpenes (Fig. 10B). The major radio-labelled product did not co-elute with any of the added unlabelled reference compounds, but one of the minor radio-labelled peaks seemed to co-elute with the reference I3-myrcene. For the H64MUT recombinant enzyme the single radio-labelled product co-eluted with linalool (Fig. 10C).15 - with [3H]-FPP as substrate scintillation counting showed that neither the SOSAnor the SOSV recombinant protein catalysed any radio-labelled product formation. The H64MUT protein catalysed the formation of a radio-labelled product which radio-GC analysis showed to be one single product, co-eluting with traps-nerolidol (Fig. 11).20 The samples were also analysed by GC-MS using a HP 5890 series II gas chromatograph equipped with an HP5-MS column (30 m x 0.25 mm i.d., 0.25 ~m df) and HP 5972A Mass Selective Detector (Hewlett-Packard). The oven was programmed at an initial temperature of 45°C for 1 min, with a ramp of 10°C min-1 to 280°C and final time of 5 min. The injection port (splitless mode), interface and MS25 source temperatures were 250, 290 and 180°C, respectively, and the He inlet pressure was controlled by electronic pressure control to achieve a constant column flow of 1.0 mL min-1. Ionization potential was set at 70 eV, and scanning was performed from 48-250 amu. The m/z 93 chromatogram of SOSV recombinant protein catalysed products from [3H]-GPP again shows several peaks (Fig. 12) as was also seen in the radio-GC30 chromatogram (Fig. 10B). The compounds were identified as a-pinene (major compound), !3-pinene, sabinene, I3-myrcene, a-phellandrene, I3-phellandrene, dihydromyrcenol (tentative), a-terpinolene (tentative) and a-terpineol (tentative). This shows that SOSV is not a sesquiterpene synthase as is claimed for a fragment nucleic acid isolated by Nam et al (Plant Mol Biol, 39: 1999-2002, 1999) and Marty (EMBL Database, Accession number AJ001452), but a monoterpene synthase, viz. an a-pinene synthase. Nam et al and Marty had isolated just a fragment of the cDNAand for example missed the 5'-side. Hence, the authors were also not able to functionally express the protein and identified it wrongly as a sesquiterpene synthase. The GC-MS chromatograms of the incubations of the H64MUT protein with [3H]-GPP or [3H]-FPP show the presence of one terpene product for each substrate and comparison of the retention times and mass spectra with authentic standards confirmed that from [3H]-GPP linalool was produced (Fig. 13) and from [3H]-FPPtraps-nerolidol (Fig. 14). Analysis using enantioselective columns showed that both linalool and nerolidol were of the S configuration, so (3S)-(E~-nerolidol and S-linalool.Characterisation. The H64NORS encoded and his-tag purified protein was shown to have an optimum pH of around 7 for both GPP and FPP.'For both substrates there was no preference for Mn2+ (at 1 mM) or Mg2+ (at 10 mM) and therefore a combination of the two was routinely used. The affinity of the enzyme for the two substrates strongly differed. The Km for FPP was 3.2 ~,M which is in the expected range for sesquiterpene synthases. However, for GPP the Km was >50 ~.M which is highly unusual. However, the apparent Vmax for GPP was much higher than for FPP. Example 7. Analysis of targeting We used transient expression assays using the Green Fluorescent Protein (GFP) to identify the sub-cellular localization of the proteins encoded by the different nucleic acid fragments described in this invention (Fig. 15). We first constructed 13 different constructs which fused in-frame the 5'-end parts of the different genes (H64NORL, H64NORS, H64TAR4, H64VES, SOSV) to the GFP gene (Fig. 16). Different regions of the 5'-ends were used part of them included a portion from the protein itself (up to the MID motifj. Expression in plants was driven by the 35S cauliflower mosaic virus promoter. Plasmid DNA from constructs was used to transform tobacco protoplasts.After transformation the protoplasts were incubated for 24 hr at 28°C in the dark and thereafter used for the analysis of GFP transient expression and subcellular localization using confocal laser scanning microscopy. The results demonstrated that the 5'-ends of both H64TAR,4 and H64VES encode a targeting signal (Fig. 15). The protein encoded by H64TAR,4 is targeted to the plastids (e.g. chloroplasts) and mitochondria while the H64VES protein is targeted to the plastids (e.g. chloroplasts). H64NORL and H64NORS, which are most active in the ripe cultivated strawberry, are targeted to the cytosol. SOSV is also targeted to the cytosol, in-contrast to all monoterpene synthases described to date which are plastid localized. Thus, according to this experiment for monoterpene synthases the cytosol and not only the plastids are a possible location and in the cytosol there are high levels of GPP to synthesize the monoterpenes. For sesquiterpene synthases normally reported to be localized in the cytosol other sub-cellular localization may be possible such as in the mitochondria and chloroplasts and they may use FPP in these compartments and produce high levels of the sesquiterpene. We also demonstrated by the same method that the different targeting signals of the terpene synthases could be easily swapped by the use of site-directed mutagenesis. For example the plastidic targeting signal encoded by the H64VES N-terminal part could be modified to dual targeting to mitochondria and chloroplasts by a change in 2 amino acid residues (Tryptophan-W6 changed to Arginine-R6 and deletion of Isoleucine-I16). Example 8. Effects of nerolidol on Agrobacterium tumefaciens FPP, the precursor for sesquiterpene biosynthesis is a most common metabolite and exists in every living organism. Thus, the expression of a protein encoding a nerolidol synthase will result in the conversion of endogenous FPP to nerolidol in most living organisms. We constructed a binary vector (plasmid used for the transformation of plants cells, which lacks the virulent genes present on the Ti plasmid of the virulent strain of Agrobacterium tumefaciens) containing the H64NORS gene flanked by a CaMV promoter (5'-end) and a Nopaline Synthase (NOS) terminator (3'-end) and used it to transform 2 different strains of Agrobacterium. In both cases no colonies were obtained after plating the transformation reaction on Luria Broth (LB) medium containing 50 mg/1 kanamycin and Rifampicin. Thus, the H64 NORS gene was expressed in Agrobacte~°ium and the protein encoded by it converted the bacterial endogenous FPP to nerolidol, which is highly toxic to the Agrobacteriurn cells, and therefore no transformants were obtained. Thus, transgenic plants expressing a nerolidol synthase will have an anti-microbial effect and could be used for the protection against Agrobacterium crown-gall disease. In order to be able to introduce a plasmid containing such a terpene synthase having toxic effects on the bacteria one can introduce one or more introns into the coding sequence of the gene. These introns can not be spliced by the bacteria and hence no functional protein is formed by the micro-organism. In the plant, the normal eukaryotic splicing process will lead to a functional protein. The introduction of suitable, organ-specific and/or inducible promoters in the appropriate construct will allow the directed expression of linalool and/or nerolidol at the appropriate site to control crown-gall disease in plants such as fruits, rose, etc. Also, slow release formulations or other compositions containing linalool and/or nerolidol may be useful to control crown-gall disease. Example 9. Effects of linalool and nerolidol on spore germination, lesion growth and sporulation of Phytophthora anfestans, Fusaraurr~ spp. and . Botryt$s spp.Comparison of effects of farnesol and linalool on mycelium growth of Phytophthora infestans on growth medium Farnesol and linalool were tested in two concentrations (2% and 0.2% (v/v)) through the addition to Plich medium in 6 well plates (3 ml per well). One 6 well plate per compound was used with two different concentrations in triplicate. All wells were inoculated with a plug of Phytophthora infestans mycelium (isolate VK98014, 1 month old) and incubated at 20°C. On day 3, 5 and 7 the radial growth of the mycelium was measured. An overview of the results is given in Figure 17. The mycelium growth of Phytophthora infestans was inhibited completely 3, 5 and 7 days after the experiment by both the high and the low concentrations of linalool. Farnesol resulted in a partial inhibition of mycelium growth at both the high and the low concentration. The experiment demonstrates that linalool is more active than farnesol for the inhibition of mycelium growth of Phytophthora infestans. Comparison of the effects of linalool and nerolidol on mycelium growth of Phytophthora infestans alone and in combination on growth medium Linalool and nerolidol were tested in three concentrations (0.2%, 0.02% and 0.002%(vlv)) through the addition to Plich medium in 6 well plates (3 ml per well). One 6 well plate per compound was used with two different concentrations in triplicate. To study whether the compounds acted directly or through the vapour phase in one plate mycelia were grown on control medium with the compounds (0.2%) added to the medium in the adjacent wells. Free exchange of the compounds through the vapour phase was possible this way. All wells were inoculated with a plug of Phytophthora infestans mycelium (isolate VK98014, 1 week old) and incubated at 20°C. On day 3 and 5 the radial growth of the mycelium was measured. The results are shown in Figures 18-21.Figure 18 shows that linalool is active even at the lowest concentration of 0.002%(=20 ppm). Remarkably, the effects of linalool are equally effective through the vapour phase as through the medium. Apparently this monoterpene is so volatile that the active concentrations in the vapour and medium phase are similar. This high activity in the vapour phase makes linalool an attractive compound for the protection of stored products against micro-organisms e.g. the protection of potato to PhytopJzthora, PJaoma, and Fusarium.Figure 19 shows that nerolidol is slightly more effective than linalool (compare Figure 18) in inhibiting Phytophthora infestans mycelium growth and that it is a strong inhibitor of mycelium growth even at the lowest concentration of 20 ppm. In contrast to linalool the effects through the vapour phase are negligible. This can be explained by the fact that the sesquiterpene nerolidol is much less volatile than the monoterpene linalool.Figures 20 and 2l show that the action of linalool and nerolidol is stronger in combination than when taken alone. This suggests that the simultaneous production of these compounds in plants could result in more effective fungal control compared to a situation when only one of the two compounds is present. The effect of nerolidol infiltrated in potato leaves on tlae germination of Phytophthora infestans spores, lesion formation and sporulation.Leaves of potato cultivar Bintje were vacuum-infiltrated with a 0.05°/ (v/v) solution of 5 nerolidol. This was done by placing 6 leaflets at a time in a 50 ml bluecap with the nerolidol solution or a water control. The tubes were placed for 15-30 min under vacuum which was then suddenly released. Good infiltration was visible by the dark green color of the leaves. The leaves had gained about 25°/ weight this way so that the actual concentration in the leaves was in the range of ca. 0.0125%. The leaves 10 were placed on water agar (1.5%) and inoculated with 250-500 spores of the different Phytophthora infestans isolates (race-0, IPO-c, 428-2, VK98014). The leaves were incubated one night in the dark at 15°C and then moved to normal lighting conditions (15°C, 16h light, 8h dark). After 7 days the leaves were scored for the formation of lesions and sporulation. The results demonstrate that also when 15 infiltrated in potato leaves nerolidol strongly inhibits mycelium growth, lesion formation and sporulation at a low concentration. The effects appear to be not race-specific but equally affecting the four different isolates showing that also nerolidol provides broad resistance against this fungus.20 Effects of linalool and nerolidol on Fusarium and Botrytis mycelial growth Fusarium. Nerolidol and linalool were tested in a range of concentrations (10-pprn) alone and in combination through the addition to Plich medium in 6 well plates (3 ml per well). In the case of comparing the application of nerolidol and linalool alone to the combination of the two compounds, 100 ppm of the single compound was for 25 example compared to 50 + 50 ppm of the two compounds together. One 6 well plate per compound was used with two different concentrations in triplicate. All wells were inoculated with a mycelium plug of Fusarium graminearum, Fusarium eulmorum or F. verticillioides strain MRC826 and incubated at 20°C. Each day the radial growth of the mycelium was measured. The results of day 7 are given in Figure 22. The 30 mycelium growth of all Fusarium spp. was inhibited at concentrations above 10 ppm.At low concentrations nerolidol was slightly more effective than linalool in the case F.graminearum and MRC826. At very high concentrations linalool was more effective. The combined use of nerolidol and linalool is at least as effective as either individual compound and appears to provide a more robust inhibition against all Fusarium species.Botrytis. Nerolidol and linalool were tested in a range of concentrations (10-ppm) alone and in combination through the addition to Plich medium in 6 well plates (3 ml per well). In the case of comparing the application of nerolidol and linalool alone to the combination of the two compounds, 100 ppm of the single compound was for example compared to 50 + 50 ppm of the two compounds together. One 6 well plate per compound was used with two different concentrations in triplicate. All wells were inoculated with a mycelium plug of Botrytis cinerea isolated from grape and strawberry and incubated at 20°C. Each day the radial growth of the mycelium was measured. The results of day 7 are given in Figure 23. The mycelium growth of all Botrytis isolates was inhibited at concentrations above 10 ppm. At low concentrations nerolidol was more effective than linalool. At very high concentrations linalool or the combination of linalool and nerolidol was most effective. The combined use of nerolidol and linalool is at least as effective as either individual compound and appears to provide the most robust inhibition against all Botrytis isolates. Effects of linalool and nerolidol on Fusarium spore germination.A spectrophotometric assay was used to monitor the onset of germination of Fusarium uerticallioides spores (isolates: ITEM2282, MRC3235, MRC826, MRC826-2) in solution. The spores were diluted to a concentration of 105 spores/ml in Czapek Dox medium and mixed with 8-4000 ppm of linalool or nerolidol. Linalool did not affect the germination of the spores at all (Figure 24B). Nerolidol, however, showed strong inhibition of germination at concentrations above 250 ppm (Figure 24A). This suggests that nerolidol provides an additional mode of control of Fusarium verticillioides at the level of spore germination in comparison to linalool and that for the most effective control at all stages of fungal development of Fusarium spp a combined use of nerolidol and linalool is most appropriate. Example 10. Transformation and characterization of Arabidopsis, potato, tomato and petunia Preparation of constructs for the transfonrcation of plants.Constructs with the H64 cDNAs are prepared for the transformation of plants in order to yield plants that will produce linalool and/or nerolidol in variuous compartments:The cDNAs are placed under the control of either the 35S promoter or the Rubisco promoter, both separately and in combination in order to obtain plants producing linalool or nerolidol alone or in combination. It is also contemplated that for some purposes glycosylation or deglycosylation of the terpene-alcohol is required for the mode of action against fungi or insects. For this reason also constructs are made containing glycosyl-transferases or glycosidases in conjunction with the linalool andlor nerolidol synthase cDNAs. Construction of binary vectors.The appropriate sequences were ligated into a pF1ap10 vector. The ligation product was transformed to E.coli DHSa competent cells, and transformed colonies were grown O/N at 37°C and 250 rpm. The expression cassette was removed from the resulting vector by using PacI and AscI restriction enzymes (NEB, England) and ligated into the binary vector pBINPLUS, containing a kanamycin resistance selection marker (nptII), after digestion with PacI and AscI. Colonies were checked after transformation by back-transformation to E. coli DHSa competent cells. Transformation of Arabidopsis We used the floral-dip transformation method to transform Atabidopsis plants ecotype Columbia according to Marsh-Martinez et al. (2002). After collecting the seeds they were let to dry for several days and then sown on MS medium containing 50 mg/1 kanamycin and 400 mg/1 cefotaxime. Green shoots, 1 cm in size were transferred to the green house and grown to maturity. Tr-ansformataon of potato On day 1 an Agrobacteraum tumefaciens culture of AGLO containing a BINPLUSderived binary vector was started in 50 ml LB-medium containing 50 mg/1 kanamycin and shaken for 2 days at 28 oC. On day 2 internodes from an in vitro culture of the potato cultivar Desiree were cut into 0.5-1 cm pieces and placed on R3B medium (30 g/1 sucrose, 4.7 g/1 Murashige and Skoog salts, pH 5.8 (KOH), 8 g!1 purified agar, 2 mg/1 NAA and 1 mg/1 BAP) which was covered with 2 sterile filterpapers that had previously been soaked in 2 ml PALM medium (30 g/1 sucrose, 4.7 g/1 Murashige and Skoog salts, 2 g!1 casein hydrolysate, pH 6.5 (KOH), 1 mglml 2,4-D and 0.5 mg/1 kinetine). The dishes were taped with parafilm and incubated overnight at 24 oCunder a regime of 16 h light. At day 3 the A. tumefaciercs culture was poured in a sterile petridish containing the explants. After 5-10 min explants are removed from the culture, placed on a sterile filter paper~to remove excess Agrobacteria and placed back on the R3B medium containing dishes after first removing the top filter paper (leaving one behind). Dishes with explants were further incubated at 24 oC and 16 h light until day 5, when the explants were transferred to dishes containing ZCVKmedium (20 g/1 sucrose, 4.7 g/1 Murashige and Skoog salts, pH 5.8 (KOH), 8 g/1 purified agar, 1 mg/1 zeatine, 200 mg/1 vancomycin, 100 mg/1 kanamycin, 200 mg/1 claforan). On day 19 and subsequently every 3-4 weeks explants were transferred to new ZCVK medium. When shoots appeared shoots were transferred to Murashige and Skoog medium containing 20% sucrose (MS20). After rooting plants were transferred to the green house Peturcaa transformation. Leaf cuttings of Petunia W115 were transformed with Agrobacterium tumefaciens strain LBA4404 using a standard plant transformation protocol (Liicker et al., The Plant Journal 27: 315-324, 2001). As a control leaf cuttings were also transformed with LBA4404 containing the pBINPLUS vector. Furthermore some non-transformed leaf cuttings were carried through the regeneration process. Rooting plants, arising from the Agrobacterium transformation were tested with PCR for the presence of the respective gene construct. Positive plants were transferred to the greenhouse. All ransgenic plants were phenotypically normal and showed a normal development compared with non-transformed control plants, which had gone through the same regeneration process. Tomato transformation.The tomato cultivar 'Micro-Tom' (Lycopersicon flavour) was used (Scott and Harbaugh, 1989). The plants were grown from seeds provided by a seed company (Beekenkamp seed, Holland). Micro-Tom seeds were first sterilised. A rinse in 70%ethanol followed by a two hour bleaching in 1.5% HC104. After bleaching, the seeds were quickly rinsed in water twice and then washed in water for ten and sixty minutes. After sterilisation, seeds were sowed in pots, containing 80m1 vermiculite and 70m1 of germination medium containing 4.4g/1 MS salts with vitamins and 0.5%sucrose (pH 5.8).After 7 days of growth in a culture room (25°C), covered with 2 folds of filter paper, the cotyledons were cut under water near the petiole and the tip with a rolling action of the scalpel, to minimize damage. The explants were placed on their backs on filter paper on feederlayers to incubate overnight in the culture room (25°C), covered with 4 folds of filter paper, under low light conditions. After incubation, the explants were immersed in the Agrobacterium suspension for 20 minutes. After immersion, the explants were placed back on feederlayers for co-cultivation, following a rinse in a solution containing 400mg/1 carbenicillin and 100mg/1 tricarcillin. The explants were placed in callus inducing medium (4.4g/1 MS salts with Nitsch vitamins, 3% sucrose, 0.8% purified agar (Oxoid), pH 6.0, 2mg/1 zeatin, 400mg/1 carbenicillin, 100mg/1 tricarcillin, 100mg/1 kanamycin). The plates were covered with 2 folds of filter paper and set to grow in a culture room (25°C) under low light conditions for 3 weeks.Formed callus was transferred to shoot inducing medium (as callus inducing medium, but with lmg/1 zeatin, 200mg/1 carbenicillin, 50mg/1 tricarcillin).These plates were set to grow under the same conditions as the callus-inducing plates. Shoots formed were transferred to rooting medium in pots (4.4g/1 MS salts with Nitsch vitamins, 3% sucrose, 0.5% agargel (Sigma), pH 6.0, 0.25mg/1 IBA, 50mg/1 kanamycin, 400mg11 carbenicillin. The growing conditions remained the same. Fully-grown plants were subsequently transferred to the greenhouse. Analysis of the transgenac plants with capillary gas chromatography- mass 5 spectrometry (GC-MS).The tissues to be analyzed were collected in the greenhouse and frozen in liquid nitrogen. In general, 200mg frozen material was homogenized and transferred to a mortar containing l.5mL 5M CaCh and a small amount of purified sea sand. These tissues were mixed with 0.75 mL 5M CaCh. The material was ground rapidly and 10 thoroughly with a pestle, inhibiting enzymatic reactions. 0.75 mL of the material was introduced into a 1.8 mL GC vial containing a small magnetic stirrer. The vial was then closed with an aluminum cap with a PTFE/Butylrubber septum. Subsequently the vial was placed in a 50°C waterbath and preheated for 20 minutes while stirring. The headspace sampled during 30 minutes with a 100, PDMS SPME fiber (Supelco, 15 Belfonte PA USA). GC-MS analysis was performed using a Fisons 8060 gas chromatograph directly coupled to a MD 800 mass spectrophotometer (Interscience, Breda, the Netherlands).A HP-5 column (50 m x 0.32 mm, film thickness 1.05 ~,m) was used with He (37 kPa) as carrier gas. GC oven temperature was programmed as follows: 2 min 80°C, ramp 20 to 250°C at 8°min~l and 5 min 250°C. Mass spectra in the electron impact mode were generated at 70 eV. The compounds were identified by comparison of GC retention indices and mass spectra with those of authentic reference compounds. Injection was performed by thermal desorption of the SPME fiber in the injector at 250°C during 1 min using the splitless injection mode with the split valve being opened after 60 sec.25 Alternatively, volatiles were trapped on cartridges containing Tenax, eluted using pentane/ether and analysed using GC-MS essentially as described by Bouwmeester et al (1998). Transgenic Arabidopsis plants expressing H64TAR, for example, produced large amounts of linalool and smaller amounts of nerolidol (Figure 25). Transgenic potato lines also produced substantial amounts of~linalool, but also the hydroxy-30 derivative 8-hydroxylinalool (Figure 26). Interestingly, the native linalool of potato, which can also be detected, had a different stereochemistry as the transgenic linalool (Fig. 26), which allowed a clear distinction between native and transgenic product. Because it was suspected that in some of the plant species these compounds were present in a bound form, leaf material of Petunia (transgenic and control samples) was harvested and frozen in liquid nitrogen, and ground to a fine powder in a cooled mortar and pestle. In total 60 mg of the powdered leaf material was transferred to 0.5 ml of citrate buffer at pH 4.5, to which 140 i.u. I3-glucosidase were added. The vial was capped and incubated during 12 h at 25°C. Subsequently, the headspace of the vial was sampled during 30 minutes with 100 micron PDMS solid phase microextraction device and analysed using GC-MS as described above. No linalool or nerolidol was detectable in samples from the untransformed control plants, whereas ZO in the transgenic plants both linalool and nerolidol were detected. The sample of transgenic leaf material without beta-glucosidase present during the incubation did not show any detectable linalool or nerolidol, indicating that all linalool and nerolidol is stored in the petunia leaves in the form of its glucoside, instead of continuous emission as was described for linalool in the flowers of Clarhia breweri. Identification of glycosides in t~°ansgenic plants High-performance-liquid-chromatography electrospray-ionization tandem mass spectrometry (HPLC-ESI-MS-MS) analysis of methanol extracts was performed on a triple stage quadrupole TSQ 7000 LC-MS-MS system with an electrospray ionization (ESI) interface (Finnigan MAT, Bremen, Germany). The temperature of the heated capillary was 240 °C. The ESI capillary voltage was set to 3.5 kV, resulting in a 3.4 ~A current. Nitrogen served as both the sheath (70 psi) and auxiliary gas (10 L/min).Data acquisition and evaluation were carried out on a Personal DECstation (Digital Equipment, Unterfohring, Germany) and ICIS ~.1 software (Finnigan MAT). HPLC separation was carried out on an Eurospher 10o C-1s column (100 x 2 mm, 5p.m, Knauer, Berlin, Germany) using a linear gradient with a flow rate of 200 ~.Lmin-1. Solvent A was 5 mM ammonium acetate in water, and solvent B was 5 mMammonium acetate in methanol. The gradient program was as follows: 0-30 min 5 to 100% B.Mass spectra were acquired in the negative mode. Product ion spectra were available by collision-induced dissociation (CID) (1.5 mTorr of Argon; -20 eV).For preparation of extracts plant leaves (3 to 7 g) were homogenized in 50 ml of 30%methanol and centrifuged (2000 g for 5 min). The residue was washed with 50 ml of ~0% methanol and the supernatants were combined. Methanol was removed in vacuum and the remaining aqueous solution was extracted with 2 x 20 ml diethyl ether. The extract was subjected to XAD-2 (20 cm, 1 cm inner diameter) solid phase extraction. The column was successively washed with 50 ml water and 50 ml diethyl ether. Glycosides were eluted with 80 ml methanol. The extract was concentrated in vacuum. The residue was dissolved in 1 ml of 50% methanol in water and analyzed by HPLC-EST-MS-MS.R,S-Linalyl I3-D-glucopyranoside~was synthesized from R,S-linalool and 2,3,4,6-tetra-O-acetyl-beta-D-glucopyranosyl bromide according to a modified Koenigs-Knorr synthesis. For enzymatic hydrolysis an aliquot of the methanol extract was dissolved in 2 ml of 0.2 M phosphate buffer (pH 5.5), and 200 ~l of Rohapect D5L (Rohm, Darmstadt, Germany), a pectinolytic enzyme preparation exhibiting glycosidase activity was added. After an incubation period of 24 h at 37°C, the liberated aglycons were extracted two times by 1 ml of diethyl ether each. The combined organic layers were dried over Na2S04 and concentrated. Multidimensional gas chromatography mass spectrometry (MDGC-MS) analyses were performed with tandem Fison 8160 GC connected to a Fison 8130 GC and a Fisons MD 800 quadrupole mass spectrometer equipped with Fisons MassLab software (Version 1.3). The first GC was fitted with a split injector (1:10, at 230 °C) and a flame ionization detector (at 250°C).The first GC employed a 25 m x 0.25 mm i.d. fused silica capillary column coated with a 0.25 ~m film of DB-Wax 20 M (J & W Scientific) for the pre-separation of the target molecule. Separation of enantiomers was achieved with the second GC using a 25 m x 0.25 mm i.d. fused silica capillary column coated with a 0.15 ~.m film of 2,3-di-O-ethyl-6-O-tert. Butyl dimethylsilyl-I3-cyclodextrin/PS086. The column in GC1 was connected by a multicolumn switching system (Fisons) to the column in GC2. The retention time of the compound of interest was determined by GC separation while the column in GC1 was connected to the FID. Separation of the enantiomers was achieved in the second GC after transfer of the compound of interest from the capillary column in GC1 to the column in GC2 via the switching device. The fused silica capillary column in GC1 was maintained at 60°C then programmed to 240°C at 10°C min-1 with He gas flow at 3 ml min-1. The fused silica capillary column in GC2 was maintained at 60°C (15 min) then programmed to 200°C at 2°C min-1 with He gas flow at 3 ml min-1. The compound of interest was transferred from GCl to GC2 from 9.8 min to 10.3 min. The MS operating parameters were ionization voltage, 70 eV(electron impact ionization); ion source and interface temperature, 230°C and 240°C, respectively. Linalyl-I3-D-glucopyranoside was synthesised in order to verify the identity of the glycoside present in the transgenic petunia tissue transformed with S-linalool synthase. HPLC-MS/MS analysis on control and transgenic Petunia tissue as shown in Figure 28, revealed that the m/z 375 ion trace (Figure 27A) of the compound detected in the transgenic Petunia tissue had the same retention time as one of the two diastereomers of (R,S)-linalyl I3-D-glucoside that are slightly resolved in ion trace A. Also the product ion spectrum of the synthesised reference compound fits the spectrum of the peak detected in the transgenic petunia tissue nicely (Figure 28B).The control Petunia tissue ion trace m/z 375 showed only a slight elevation above background level at the retention time of the linalyl !3-D-glucoside indicating that there is also a basal level of linalyl-I3-D-glucoside present in the plant before transformation (Figure 28A). Following Chiral phase Multidimensional Gas Chromatography Mass Spectrometry (MDGC-MS) analysis, after enzymatic hydrolysis of the glucoside fraction of leaf tissue, revealed that the transgenic Petunia leaf contains highly enriched (S)-linalyl-I3-D-glucoside. The control plant however contains slightly enriched (R)-linalyl-I3-D-glucoside. Since no tissue-specific promoter for expression was used, the enzyme can be formed in all plant organs and will give a product in all cells where GPP is present. By the action of a highly active endogenous glucosyltransferase of Petunia that is able to efficiently bind the S-linalool produced by the transgenic plants as (S)-linalyl-Pr-D-glucoside, cellular damage is prevented.Such a highly active glycosyltransferase was also reported in transgenic Kiwi fruit expressing stilbene synthase, that accumulated picied (resveratrol-glucoside) in stead of resveratrol. Large-scale volatilisation of linalool from the transgenic plants could be excluded, since only traces of linalool were detectable when the headspace of the transformed plants was analysed. Volatilisation only occurred from the flowers and not from leaves. This in contrast to Arabidopsis where large amounts of linalool were emitted from the leaves (Figure 25). Therefore we conclude that most of the linalool in Petunia is directly bound as a 13-D-glucoside. Further analysis of potato-leaf extracts also showed the presence of glucosides, not only of linalool itself but also of ~-hydroxylinalool. In addition, more derivatives of linalool were found such as linalool-triol, including the corresponding glucoside (Table 1).In conclusion, transgenic plants expressing the inserted transgenes are shown to produce the expected terpenoid compounds. Their amounts, release, oxidation to polyols, and derivatization to glycosides vary from species to species and can be influenced by the co-expression of other sequences (see Example 11). When these compounds are not stored in any bound intermediates such as glycosides, the plants have altered olfactory characteristics. Table 1.control TM9TM13 TM29 sample weight (g) 3.5 3.54.1 3.0 linalool0.3 6.64.0 10.5 (~.g/g fresh weight) by GC-MS 8-hydroxylinalool 0.1 3.72.1 4.7 (~.g/g fresh weight) by GC-MS linalooltriol < 0.1 < 0.1 < 0.10.3 (~.glg fresh weight) by GC-MS glycosidically bound0.4 3.30.6 1.0 linalool (~,g/g fresh weight) by GC-MS glycosidically bound1.6 18.7 8.9 27.2 8-hydroxylinalool (~.g/g fresh weight) by GC-MS glycosidically bound< 0.1 3.31.4 5.8 linalooltriol (~g/g fresh weight) by GC-MS linalylglucoside17 83 55 90 (~,g/g fresh weight) by LC-MS hydroxylinalylglucoside tentatively (~.g/g fresh weight) by LC-MS linalyltriolglucoside< 139 24 38 tentatively (~.g/g fresh weight) by LC-MS linalool74:26 5:955:95 1:99 enantiomeric ratio (R:S) by MDGC-MS glycosidically bound96:4 1:992:98 1:99 linalool enantiomeric ratio by MDGC-MS Example 11. Effects of changes in targeting of terpenoid and GPP and FPPsynthases Example 10 shows that we are able to produce large amounts of monoterpenes in a range of different species, and that it is not necessary to introduce a GPP synthase unlike was claimed in WO 0022150. However, the production of sesquiterpenes in transgenic plants proved difficult, as has been reported by several other authors (Wallaart et al., Planta 212: 460-465, 2001; Hohn and Ohlrogge, Plant Physiol 97:460-462, 1991).Therefore, the effect of introducing an additional gene encoding an FPP synthase to wild-type plants or plants which already over-express a sesquiterpene synthase on sesquiterpene production was examined using Arabidopsis thalian,a plants (ecotype Columbia). Two genes were introduced in two ways, either by co-transformation of two binary vectors harboring the different genes or by retransforming a plant already transformed with a single gene, and selecting on a new selectable marker (hygromycin instead of kanamycin that was used in the first gene transformation).Single genes included an FPP synthase from strawberry encoding a cytosolic protein (FPPS), FPP synthase with a plastid targeting signal (TARFPPS) and a germacrene A synthase gene (GERA, sesquiterpene synthase) that was isolated from chicory (PCT/EP 0002130). Co-transformation was performed with the following combinations of genes:1. FPPS and a plastid localized H64NORS (H64TAR) 2. TARFPPS and H64TAR3. FPPS and H64NORS (cytosolic) 4. FPPS and GERA.To prevent problems with the introduction of the H64NORS containing plasmid to Agrobacterium (see Example 3) we introduced an intron to the H64NORS gene which can not be processed by the bacteria but can be processed by the plant. The combination of cytosolic FPP synthase and a plastidic sesquiterpene synthase was performed in order to check whether the pool of FPP in the plastids can be increased by transport from the cytosol to the plastids. A number of selfed progeny lines of a high linalool and nerolidol producing line due to the introduction of a plastidic H64NORS (H64TAR) were also co-transformed with the FPPS and TARFPPS genes.GC-MS analysis of the resulting trangenic plants showed that the co-expression of a cytosolic FPP synthase and cytosolic sesquiterpene synthase greatly enhances the production of the sesquiterpenes nerolidol (combination 3) and germacrene A(combination 4). Also, overexpression of a cytosolic FPP synthase did enhance nerolidol production in case of the plastid-targeted H64NORS (combination 1). Co-expression of an FPP synthase and H64NORS in the plastids (combination 2) did result in appreciable levels of both linalool and nerolidol. This shows that it is possible to boost (transgenic) sesquiterpene biosynthesis in the cytosol by enhancing substrate availability and that it is possible to direct sesquiterpene biosynthesis to other compartmments than the cytosol. Example 12. Transgenic plants with improved biological control of pests Linalool and nerolidol, and its derivative 4,8-dimethyl-1,3(E~,7-nonatriene have been reported to play an important role in the attraction of predators of a variety of insect and spider mite pests by a large number of crops. The sequences described in the present invention can be used as markers for the selection of crop species, such as for example maize, cotton, apple, and cucumber, and any other crops employing this indirect defense mechanism, with improved production of volatile, predator attracting, compounds in response to feeding pests. In addition, the present invention can be used to make transgenic plants with improved signalling capacity. Hereto the DNA sequences are placed under the control of an inducible promoter, such as wound-inducible or specific inducible promoters. The latter type of promoters are isolated from plants that were fed upon by for example spider mites or insects. Spider mite inducible promoters can for example be isolated from cucumber or lima bean.These plant species have been shown to strongly react to spider mite feeding with the production of volatile signaling compounds (Bouwmeester et al., 1999). Subtractive (up- and down-regulated) libraries are made from non-infested (control) and infested plant material using the PCR-Select~M cDNA Subtraction Kit (Clontech), and the expression of the cDNAs in these subtractive libraries checked using cDNA micro-array technology (see for example Aharoni et al., 2000) using mRNA from control, spider-mite infested and JA-treated plant materials as probes for hybridisation.Regulated cDNAs will be sequenced, and BLASTed to hint their identity. The full-length cDNAs of interesting, strongly regulated genes are obtained using the RACEPCR technology, or by screening a cDNA library. The interesting full-length cDNAs are characterised for their expression profile and using heterologous expression or model plant transformation. Promoters of strongly (up-)regulated genes are isolated using the Genome WalkerTM kit (Clontech). As mentioned above the DNA sequences from the invention are placed under the control of wound-inducible or the isolated suitable (tissue-) specific (inducible) promoters and used for transformation of crops in which biological control is enabled by the production of inducible volatile signalling compounds, such as cucumber, maize and cotton, using published protocols. Transformation of cucumber is carried out using a protocol for gene transfer and regeneration of cucumber as developed by a Dutch seed company.The altered response of the transgenic plants is determined using jasmonic acid treated and spider mite or beet army worm infested transgenic and control plants. Volatile production is determined using headspace trapping and GC-MS analysis (Bouwmeester et al., 1999). The response of the respective predators is determined using behavioural studies using a Y-tube olfactometer (e.g. Takabayashi et al., J.Chem. Ecol. 20(2), 373-385, 1994). The transgenic Arabidopsis from Example 10 was shown to produce large amounts of linalool and smaller amounts of nerolidol. In a Y-tube experiment, starved predatory mites (Phytoseiulus persimvlas) were shown to strongly prefer the linalool/nerolidol producing plants: 70% of the tested predatory mites preferred the transgenic Arabidopsis above the wild type. Example 13. Effects of linalool and nerolidol expression on resistance to micro-organisms Several plant species expressing the H64NORS gene and producing elevated levels of linalool and nerolidol were analyzed for resistance to microbial infections of powdery mildew and Phytophthora infestarts. Clear effects were observed on leaves and fruits showing that the in vitro data presented in Example 7 are predictive of the in uiuo data in transgenic plants. Petunia and~owdery mildew 5 Transformed tomato plants (control (empty vector) and transgenic homozygous for the trait) were grown from seed in a small greenhouse under identical controlled conditions (n=30). The plants were inoculated with powdery mildew (Erysiphe cichoracearum) spores. After 4 weeks plants were scored for infection. The results indicate that the the presence of linalool protected the plants from infection by 10 mildew (Table 2).Table 2. Infection of wildtype and transgenic linalool producing Petunia plants with powdery mildew HeavilyModeratelyClean infected infected (lower, older leaves) Control empty vector 75%25% Homozygous for linalool 10% 90% Tomato and Phytoplathora infestans Green fruits were harvested from various homozygous transgenic Microtom tomato lines. Earlier these lines had been characterized for linalool content by steam destillation and GC-MS. Ten different berries from each transgenic line were inoculated by pricking the top of the fruit with a tooth pick dipped in a suspension of 10,000 sporangialml of Phytophthora infestans IP042~-2. After 7 days the fruits were scored for infection level (Table 3). Nearly all diseased fruits had turned completely grey/black just below the skin. Fruits were scored clean if they had no infection at all. A strong correlation was observed between a high linalool expression level and a low percentage of diseased berries. The transgenic fruits with high linalool levels largely remained free of infection Table 3. Relationship between linalool production and Phytophthora infestans infection of green fruits for different transgenic lines.Tomato line % diseased berries quantity of linalool (arbitrary units) control 60 465 1A 70 2,000 1C 50 3,778 1B 30 22, 989 1BA 10 18,125 Potato and Playtophthora infestans Transgenic potato lines expressing the H64NORS gene in two different constructs (H64NOR and H64TAR) were analysed for production of linalool and nerolidol in the headspace using an SPME fiber and GC-MS. The H64NOR construct did not yield ner0lidol or linalo0l production above the background present in potato, while the H64TAR construct gave very high levels of linalool and low levels nerolidol in the headspace. Both sets of plants were tested for Phytophthora infestans resistance by inoculating 5 detached leaves in 2 replicates with spore suspensions and scoring lesion area, lesion growth and sporulation (Table 4). A very strong correlation was observed between high linalool expression levels and strongly repressed or absent lesion growth and sporulation. Table 4. Effect of different constructs on linalool production and Phytophthora infestaras lesion growth and sporulation ConstrucPotato lLesion lLesion growthiSporulationLinalool t genotypeTarea rate (LGR: (7 dpi) (x102 ransgenic(mm~)mm/day) t5-7 arb. units) line dpi(5 min/measurement) H64NOR I5 271 4.2 1.4 625 I12 506 7.7 2.8 1125 I20 294 5.2 2 1275 I23 456 8.0 2.6 1150 I27 574 8.5 3.4 3750 I30 458 7.0 2.3 1675 T9 79 1.6 0.8 390000 T13 123 3.7 0.8 152000 T24 143 2.3 0.8 390000 T29 00. 0 157000 1 Five leaves per genotype were each inoculated with 1 drop of 10 microliter inoculum per leaf (IP0428-2, 50.000 sporangia/ml) and scored for lesion area, growth and sporulation (visual score on a scale of 0-4) at the indicated days post infection (dpi) Figure 30 combines the data of table 1 and 4. Figures 30 A, B and C provide the correlation in lesion sire, lesion growth rate, and sporulation respectively of Phytoplathora infestans isolate IPO 428-2 plotted against the content of linalool, 8-hydroxylinalool, linalooltriol, lynalylglucoside, 8-hydroxylinalylglucoside and linalyltriolglucoside content of the potato transgenic lines T or TM-9, -13, -29 and a control line. The control data from table 4 on fungal growth and sporulation were taken to be the average values of the H64NOR plants (I-lines) with negligible increased levels of either linalool, nerolidol or derivatives. The linalool (derivative) data provided in table 1 are known to the art to be much more reliable and quantitative than the SPME data on linalool in table 4, which justifies their preferred use. Figure 30 demonstrates a strong dose-effect correlation of the levels of linalool (derivatives) produced in potato to the levels of resistance. With high levels of terpene expression clearly complete resistance to Phytophthora infestans infection was obtained. Furthermore, figure 30 D provides the in vitro data on the sensitivity of Phytophthora anfestans isolate IP0428-2 which was used for the in planta experiments to pure linalool in the medium as described in Example 9. From the comparison of the in uitro data with the an planta data of Figure 30 it is clear that the quantities produced in planta are in the same range as the quantities required an vitro to affect the mycelial growth. It is not clear, however, whether the naturally formed alcohol and glucoside derivatives of linalool are similarly active to inhibit fungal growth as the free underived linalool forms and may contribute to the effect of free linalool in a major way. Example 14. Effect of linalool and nerolidol expression on insect resistance Arabadopsis thczliana and Myzus persicae A line of A~°abadopsis thaliana transformed with the H64TAR construct was characterized to have a single gene insertion by Southern blot, high headspace levels of linalool and lower headspace levels of nerolidol (Example 10). This line was selected and selfed. Selfed seeds were sown and young, non-flowering plants were analysed for levels of linalool in the headspace using SPME GC-MS analysis (Example 10). Homo- and heterozygous plants with high levels of linalool were used in a bioassay with Myzus persicae female adults to observe repellent or deterrent effects of linalool expression (Table 5), For each experiment two leaves were taken from the plant, one from a control and one from a linalool plant and embedded next to each other in gelling wateragar of a small petridish. Ten adult females were placed on the inside of the lid of the petridish. After preset times the number of adults on each of the leaves was recorded. A deterrent effect was visible over time. Initially the aphids did not display any preference but after 2 days a very significant distribution was observed in which 62% were on control plants and 38% were on linalool plants.This indicates that linalool and/or nerolidol are potential insect deterrents or repellents in plants that can express high levels of these compounds. 'able 5. Effect of linalool production in transgenic Arabidopsis on choice of aphids. Time afterAphids on controlAphids on linaloolSignificance inoculation A. expressing A. (P-value, t-test) (hours) thalianathaliana line (1) (f) 0.25 50 50 0.47 1 52 47 0.31 4 58 41 0.05 2056 43 0.09 24 57 42 0.2 2659 40 0.11 4562 37 0.003 Sequences Note: Nucleic acid sequence (A); Translation of nucleic acid sequence of A (B) or if sequence contains an intron: (A) Nucleic acid sequence including intron; (B) Nucleic 5 acid sequence from (A) excluding intron; (C) Translation of nucleic acid from (B). INFORMATION FOR NO: 1A (H64NORL) SEQUENCE CHARACTERISTICS:10 LENGTH:1874 TYPE: cDNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY SEQUENCE DISCRIPTION FOR NO: 1A CTAATACGACTCACTATAGGGCAAGCAGTGGTAACAACGCAGAGTACGCGGGGA CAACTTAAGTTCTTAATTCGCAAACAAAGATCAAGAAGAGCGAAAGAAATATCAT CTTCTTTAAAGTATTCAATCCTCAAATTGCCTGCTACTTTTGAGATAGCTTGCTTC CCAGTTCTATTACTATAAAGCCGATGAACGTTGAAACCAAGCATACTAGAACTAT GGGTGACATTTTTGTCCAACATTCTCAGAAGTTGGAACTATTGAAA.ACTGTCTTG AGGAATGTAGCAGAGCTAGATGCCCTTGAAGGTTTGAATATGATCGATGCTGTTC GCAAATGAGTATTGTGTCTGCCCGTGATGATCTTCATGAGGTTGCACTTCGCTTT CGACTACTGAGACAACATGGTTACTTCGTGCCTGAAGATGTGTTTAACAACTTCA AGGACAGCAAAGGAACGTTCAAGCAAGTTCTGGGTGAAGACATCAAGGGATTGA TGAGCTTATACGAAGCTTCGCAGCTAGGTACAGAAGGAGAAGATATACTTGTTGA30 AGCTGAAA.AGTTTAGCGGCCATCTGCTAAAGACTTCTCTGTCACATCTTGATCAT CATCGAGTCAGAATTGTTGCAAATACATTGAGGAATCCTCATCACAAAAGCTTGG CCCCATTCATGGCCAGGAACTTTTTCGTTACTTCTCAAGCCACCAATTCATGGTTA AATTTGCTAAAAGAAGTAGCAA.AA.ACAGATTTCAATATGGTCCGGTCTCTGCACC AGAATGAAATAGTTCAAATGTCCAAATGGTGGAAGGAGCTTGGATTGGCTAAGG AACTGAAGTTTGCAAGAGATCAACCACTGAAATGGTACATTTGGTCCATGGCATG CCTGACAGATCCAAAGTTATCAGAGGAGAGGGTTGAGCTCACAA.AACCCATCTCT TTTGTCTATTTGATAGATGACATTTTCGATGTTTATGGAACCCTTGATGACCTCAT TCTCTTCACAGAAGCTGTTAATCGATGGGAA.ATTACTGCTATAGACCACTTACCA GACTATATGAAGATATGCTTCAAGGCTCTCTATGATATGACTAATGAATTCAGCA GCAAGGTCTATCTGAAGCATGGATGGAACCCCTTACAATCTTTGAAAATTTCGTG GGCGAGTCTTTGCAATGCATTTTTGGTGGAAGCAAAATGGTTCGCCTCTGGGAAG CTGCCGAAGTCAGAAGAGTACTTGAAGAATGGCATCGTTTCTTCTGGGGTAAATG TGGTTCTAGTCCACATGTTTTTTCTCTTGGGTCAGAACATAACCAGAAAGAGTGT GGAGTTGTTGAATGAAACTCCAGCCATTATATCGTCCTCAGCAGCAATTCTTCGA CTCTGGGACGATTTAGGAAGTGCAAAGGATGAGAACCAGGATGGGAACGATGGG TCGTATGTAAGGTGCTACTTAGAGGAACATGAAGGCTGTTCCATTGAGGAGGCAC GAGAAAAGACGATTAATATGATTTCAGATGAATGGAAGAAACTGAACAGAGAACT GCTCTCTCCAAATCCATTTCCAGCATCATTCACATTGGCTTCTCTTAATCTCGCAA GAATGATCCCCTTGATGTATAGCTACGATGGCAACCAATGCCTTCCATCTCTTAA AGAGTATATGAAACTGATGTTGTATGAGACTGTATCAATGTAATTAATAATAAGA CTACCGGAAGTGGAGTTGAACTTCAAAGGTGGGTGGTCAAGAGAAACAAGAAGC CTAAG INFORMATION FOR NO: 1B (H64NORL) SEQUENCE CHARACTERISTICS: LENGTH: 519 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY LINALOOL/NEROLIDOL SYNTHASE SEQUENCE DISCRIPTION FOR NO: 1B MNVETKHTRTMGDTFVQHSQKLELLKTVLRNVAELDALEGLNMIDAVQRLG IDYNFQREIDEILHKQMSIVSARDDLHEVALRFRLLRQHGYFVPEDVFNNFK DSKGTFKQVLGEDIKGLMSLYEASQLGTEGEDILVEAEKFSGHLLKTSLSHL DHHRVRTVANTLRNPHHKSLAPFMARNFFVTSQATNSWLNLLKEVAKTDFN MVR,SLHQNEIVQMSKWWKELGLAKELKFARDQPLKWYIWSMACLTDPKLS EERVELTKPISFVYLIDDIFDVYGTLDDLTLFTEAVNRWEITAIDHLPDYMKI C FKALYDMTNEFSSKVYLKHGWNPLQSLKISWASLCNAFLVEAKWFASGKLP KSEEYLKNGIVSSGVNWLVHMFFLLGQNITRKSVELLNETPAIISSSAAILRL WDDLGSAKDENQDGNDGSYVRCYLEEHEGCSIEEAREKTINMISDEWKKLN RELLSPNPFPASFTLASLNLARMIPLMYSYDGNQCLPSLKEYMKLMLYETVS M1~INFORMATION FOR NO: 2A (H64NORS) SEQUENCE CHARACTERISTICS: LENGTH: I63I TYPE: cDNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY LINALOOL/NEROLIDOL SYNTHASE SEQUENCE DISCRIPTION FOR NO: 2A ATGAACGTTGAAACCAAGCATACTAGAACTATGGGTGACATTTTTGTCCAACATT CTCAGAAGTTGGAACTATTGAAA.ACTGTCTTGAGGAATGTAGCAGAGCTAGATGC CCTTGAAGGTTTGAATATGATCGATGCTGTTCAAAGGCTAGGCATCGATTACAAC TTTCAACGAGAAATCGACGAAATCCTGCACAAGCAAATGAGTATTGTGTCTGCCC GTGATGATCTTCATGAGGTTGCACTTCGCTTTCGACTACTGAGACAACATGGTTA CTTCGTGCCTGAAGATGTGTTTAACAACTTCAAGGACAGCAAAGGAACGTTCAAG CAAGTTCTGGGTGAAGACATCAAGGGATTGATGAGCTTATACGAAGCTTCGCAGC TAGGTACAGAAGGAGAAGATATACTTGTTGAAGCTGAAA.AGTTTAGCGGCCATCT GCTAAAGACTTCTCTGTCACATCTTGATCATCATCGAGTCAGAATTGTTGCAAATA CATTGAGGAATCCTCATCACAA.AAGCTTGGCCCCATTCATGGCCAGGAACTTTTT CGTTACTTCTCAAGCCACCAATTCATGGTTAAATTTGCTAAAAGAAGTAGC_A_A_A_A_ ACAGATTTCAATATGGTCCGGTCTCTGCACCAGAATGAAATAGTTCAAATGTCCA AATGGTGGAAGGAGCTTGGATTGGCTAAGGAACTGAAGTTTGCAAGAGATCAAC CACTGAAATGGTACATTTGGTCCATGGCATGCCTGACAGATCCAAAGTTATCAGAGGAGAGGGTTGAGCTCACAAAACCCATCTCTTTTGTCTATTTGATAGATGACATT TTGGATGTTTATGGAACCCTTGATGACCTCATTCTCTTCACAGAAGCTGTTAATCG ATGGGAAATTACTGCTATAGACCACTTACCAGACTATATGAAGATATGCTTCAAG GCTCTCTATGATATGACTAATGAATTCAGCAGCAAGGTCTATCTGAAGCATGGAT GGAACCCCTTACAATCTTTGAAA.ATTTCGTGGGCGAGTCTTTGCAATGCATTTTT GGTGGAAGCAAA.ATGGTTCGCCTCTGGGAAGCTGCCGAAGTCAGAAGAGTACTT GAAGAATGGCATCGTTTCTTCTGGGGTAAATGTGGTTCTAGTCCACATGTTTTTT CTCTTGGGTCAGAACATAACCAGAAAGAGTGTGGAGTTGTTGAATGAAACTCCAG CCATTATATCGTCCTCAGCAGCAATTCTTCGACTCTGGGACGATTTAGGAAGTGC AAAGGATGAGAACCAGGATGGGAACGATGGGTCGTATGTAAGGTGCTACTTAGA GGAACATGAAGGCTGTTCCATTGAGGAGGCACGAGA.A.A.AGACGATTAATATGAT TTCAGATGAATGGAAGAAACTGAACAGAGAACTGCTCTCTCCAAATCCATTTCCA GCATCATTCACATTGGCTTCTCTTAATCTCGCAAGAATGATCCCCTTGATGTATAG CTACGATGGCAACCAATGCCTTCCATCTCTTAAAGAGTATATGAAACTGATGTTG TATGAGACTGTATCAATGTAATTAATAATAAGACTACCGGAAGTGGAGTTGAACT TCAAAGGTGGGTGGTCAAGAGAAACAAGAAGCCTAAG INFORMATION FOR NO: 2B (H64NORS) SE(~UENCE CHARACTERISTICS: LENGTH: 519 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY LINALOOL/NEROLIDOL SYNTHASE SEQUENCE DISCRIPTION FOR NO: 2B MNVETKHTRTMGDIFVQHSQKLELLKTVLRNVAELDALEGLNMIDAVQRLGIDY NFQREIDEILHKQMSIVSARDDLHEVALRFRLLRQHGYFVPEDVFNNFKDSKGTF KQVLGEDIKGLMSLYEASQLGTEGEDILVEAEKFSGHLLKTSLSHLDHHRVRIVA NTLRNPHHKSLAPFMARNFFVTSQATNSWLNLLKEVAKTDFNMVRSLHQNEIVQ MSKWWKELGLAKELKFARDQPLKWYIWSMACLTDPKLSEERVELTKPISFVYLID DIFDVYGTLDDLILFTEAVNRWEITAIDHLPDYMKICFKALYDMTNEFSSKVYLKH GWNPLQSLKISWASLCNAFLVEAKWFASGKLPKSEEYLKNGIVSSGVNWLVHMF FLLGQNITRKSVELLNETPAIISSSAAILRLWDDLGSAKDENQDGNDGSYVRCYLE EHEGCSIEEAREKTINMISDEWKKLNRELLSPNPFPASFTLASLNLAR,MIPLMYSY DGNQCLPSLKEYMKLMLYETVSM INFORMATION FOR NO: 3A (H64MUT) SEQUENCE CHARACTERISTICS: LENGTH:1874 TYPE: cDNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY LINALOOL/NEROLIDOL SYNTHASE SEQUENCE DISCRIPTION FOR NO: 3A CTAATACGACTCACTATAGGGCAAGCAGTGGTAACAACGCAGAGTACGCGGGGA CAACTTAAGTTCTTAATTCGCAAACAAAGATCAAGAAGAGCGAAAGAAATATCAT CTCCCACAGCTTCTTAGTTGCTGATCATAGATCAGATGGCATCGTCTTCTCGGGC CTTCTTTAAAGTATTCAATCCTCAAATTGCCTGCTACTTTCTAGATAGCTTGCTTC CCAGTTCTATTACTATAAAGCCGATGAACGTTGAAACCAAGCATACTAGAACTAT GGGTGACATTTTTGTCCAACATTCTCAGAAGTTGGAACTATTGAA.AACTGTCTTG AGGAATGTAGCAGAGCTAGATGCCCTTGAAGGTTTGAATATGATCGATGCTGTTC AAAGGCTAGGCATCGATTACAACTTTCAACGAGAAATCGACGAAATCCTGCACAA GCAAATGAGTATTGTGTCTGCCCGTGATGATCTTCATGAGGTTGCACTTCGCTTT CGACTACTGAGACAACATGGTTACTTCGTGCCTGAAGATGTGTTTAACAACTTCA AGGACAGCAAAGGAACGTTCAAGCAAGTTCTGGGTGAAGACATCAAGGGATTGA TGAGCTTATACGAAGCTTCGCAGCTAGGTACAGAAGGAGAAGATATACTTGTTGA AGCTGAA.A.AGTTTAGCGGCCATCTGCTAAAGACTTCTCTGTCACATCTTGATCAT CATCGAGTCAGAATTGTTGCAAATACATTGAGGAATCCTCATCACAAA.AGCTTGG AATTTGCTAAAAGAAGTAGCAAA.A.ACAGATTTCAATATGGTCCGGTCTCTGCACC AGAATGAAATAGTTCAAATGTCCAAATGGTGGAAGGAGCTTGGATTGGCTAAGG AACTGAAGTTTGCAAGAGATCAACCACTGAAATGGTACATTTGGTCCATGGCATG CCTGACAGATCCAAAGTTATCAGAGGAGAGGGTTGAGCTCACAA.AACCCATCTCT TCTCTTCACAGAAGCTGTTAATCGATGGGAAATTACTGCTATAGACCACTTACCA GACTATATGAAGATATGCTTCAAGGCTCTCTATGATATGACTAATGAATTCAGCA GCAAGGTCTATCTGAAGCATGGATGGAACCCCTTACAATCTTTGAAAATTTCGTG GGCGAGTCTTTGCAATGCATTTTTGGTGGAAGCAAAATGGTTCGCCTCTGGGAAG TGGTTCTAGTCCACATGTTTTTTCTCTTGGGTCAGAACATAACCAGAAAGAGTGT GGAGTTGTTGAATGAAACTCCAGCCATTATATCGTCCTCAGCAGCAATTCTTCGA CTCTGGGACGATTTAGGAAGTGCAAAGGATGAGAACCAGGATGGGAACGATGGG TCGTATGTAAGGTGCTACTTAGAGGAACATGAAGGCTGTTCCATTGAGGAGGCAC GCTCTCTCCAAATCCATTTCCAGCATCATTCACATTGGCTTCTCTTAATCTCGCAA GAATGATCCCCTTGATGTATAGCTACGATGGCAACCAATGCCTTCCATCTCTTAA AGAGTATATGAAACTGATGTTGTATGAGACTGTATCAATGTAATTAATAATAAGA CTACCGGAAGTGGAGTTGAACTTCAAAGGTGGGTGGTCAAGAGAAACAAGAAGC INFORMATION FOR NO: 3B (H64MUT) SEQUENCE CHARACTERISTICS: LENGTH: 552 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY LINALOOL/NEROLIDOL SYNTHASE SEQUENCE DISCRIPTION FOR NO: 3B MASSSRAFFKVFNPQIACYFLDSLLPSSITIKPMNVETKHTRTMGDIFVQHSQKLE LLKTVLRNVAELDALEGLNMIDAVQRLGIDYNFQREIDEILHKQMSIVSARDDLHE VALRFRLLRQHGYFVPEDVFNNFKDSKGTFKQVLGEDIKGLMSLYEASQLGTEGE DILVEAEKFSGHLLKTSLSHLDHHRVRIVANTLRNPHHKSLAPFMARNFFVTSQATNSWLNLLKEVAKTDFNMVRSLHQNEIVQMSKWWKELGLAKELKFARDQPLKW YIWSMACLTDPKLSEERVELTKPISFVYLIDDIFDVYGTLDDLILFTEAVNRWEITAI DHLPDYMKICFKALYDMTNEFSSKVYLKHGWNPLQSLKISWASLCNAFLVEAKW FASGKLPKSEEYLKNGIVSSGVNVVLVHMFFLLGQNITRKSVELLNETPAIISSSAA ILRLWDDLGSAKDENQDGNDGSYVRCYLEEHEGCSIEEAREKTINMISDEWKKLN RELLSPNPFPASFTLASLNLARMIPLMYSYDGNQCLPSLKEYMKLMLYETVSM INFORMATION FOR NO: 4A (H64VES) SEQUENCE CHARACTERISTICS: LENGTH: 1594 TYPE: cDNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: WILD STRAWBERRY LINALOOL/NEROLIDOL SYNTHASE SEQUENCE DISCRIPTION FOR NO: 4A AAGCAGTGGTAACAACGCAGAGTACGCGGGGACAACTGAAGTTCTTAATTCGCA AACAAAGATCAAGAAGAGCGAAAGAAGTATCATCTCCCGCCTTAGGTGCTGATCA TAGATCAGATGGCATCGTCTTCTTGGGCCTTCTTTAAAGTATTCAATCCCCAA.ATT GCTCCAAAAAGTATCTCACATATTGGCCAGTCTGACCTCATGCAGCTTACACATA AGAAGCAGCTGCCTACTTTTCAAAGACGGGGCATTGCCGAAGATAGCTTGCTTCC CAGTTCTACTACTCCCATAAAGCCGATGCACGTTGAAACCAAGCATACTAGAACT ATGGGTGACATTTTTGTCCAACATTCTCAGAAGTTGGAACTATTCAGAAATGTCTT GAGGAATGCAGCAGAGCTAGATGCCCTTGAAGGTTTGAATATGATCGATGCCGTT CAAAGGCTAGGCATCGATTACCACTTTCAACGAGAAATCGACGAAATTCTGCACA AGCAAATGGGTATTGTATCTGCCTGTGATGATCTTTATGAGGTTGCACTTCGTTT TCGACTACTGAGACAACATGGTTACTTCGTGCCTGAAGATGTGTTTAACAACTTC AAGGACAGCAAAGGAACTTTCAAGCAAGTTCTGGGTGAAGACATCAAGGGATTG ATGAGCTTATACGAAGCTTCGCAGCTAGGTACAGAAGGAGAAGATACACTTGTTG AAGCTGAAA.AGTTTAGTGGCCATCTGCTAAAGACTTCTCTGTCACATCTTGATCG TCATCGAGCCAGAATTGTTGGAAATACATTGAGGAATCCTCATCGCAAA.AGCTTG GCCTCATTCATGGCCAGGAACTTTTTCGTTACTTCTCAAGCCACCAATTCATGGTT AAATTTGCTAAA.AGAAGTAGCAAA.AACAGATTTCAATATGGTCCGGTCTGTGCAC CAGAAAGAAATAGTTCAAATTTCCAAATGGTGGAAGGAGCTTGGATTGGTTAAGG AACTGAAGTTTGCAAGAGATCAACCACTGAAATGGTACACTTGGTCCATGGCAGG CCTAACAGATCCAAAGTTATCAGAGGAGAGGGTTGAGCTCACAA.AACCCATCTCT TTTGTCTATTTGATAGATGACATTTTCGATGTTTATGGAACCCTTGATGACCTCAT TCTCTTCACAGAAGCTGTTAATAGATGGGAAATTACTGCTATAGACCACTTACCA GACTATATGAAGATATGCTTCAAGGCTCTCTATGATATGACTAATGAATTCAGCT GCAAGGTCTATCAGAAGCATGGATGGAACCCCTTACGATCTTTGAAAATTTCGTG GGCGAGTCTTTGCAATGCGTTTTTGGTGGAAGCAAAATGGTTCGCATCTGGGCA GCTGCCGAAGTCAGAAGAGTACTTGAAGAACGGCATCGTTTCTTCTGGGGTAAAT GTGGGTCTAGTCCACATGTTTTTTCTCTTGGGTCAGAACATAACCAGAAAGAGTG TGGAGTTGTTGAATGAAACTCCAGCCATGATATCGTCCTCAGCAGCAATTCTTCG ACTCTGGGACGATTTAGGCAGTGCAAAGGATGAGAACCAGGATGGGAACGATGG GTCGTATGTAAGGTGCTACTTAGAGGAACATGAAGGCTGTTCCATTGAGGAGGC ACGAGAA.AAGACGATTAATATGATTTCAGATGAATGGAAGAAACTGAACAGAGAA CTGCTCTCTCCAAATCCATTTCCAGCAACATTCACATCGGCTTCTCTTAATCTCGC AAGAATGATCCCCTTGATGTATAGCTACGATGGCAACCAATCCCTTCCATCTCTT AA.AGAGTATATGAAACTGATGTTGTATGAGACTGTATCAATGTAATTGATAATAA GACTGCTGGAAGTGGAGTTGAACA INFORMATION FOR NO: 4B (H64VES) SEQUENCE CHARACTERISTICS: LENGTH: 580 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: WILD STRAWBERRY LINALOOL/NEROLIDOL SYNTHASE SEQUENCE DISCRIPTION FOR NO: 4B MASSSWAFFKVFNPQIAPKSISHIGQSDLMQLTHKKQLPTFQRRGIAEDSLLPSST TPIKPMHVETKHTRTMGDIFVQHSQKLELFRNVLRNAAELDALEGLNMIDAVQRL GIDYHFQREIDEILHKQMGIVSACDDLYEVALRFRLLRQHGYFVPEDVFNNFKD S KGTFKQVLGEDIKGLMSLYEASQLGTEGEDTLVEAEKFSGHLLKTSLSHLDRHRA RIVGNTLRNPHRKSLASFMAR,NFFVTSQATNSWLNLLKEVAKTDFNM:VRSVHQK EIVQISKWWKELGLVKELKFARDQPLKWYTWSMAGLTDPKLSEERVELTKPISFV YLIDDIFDVYGTLDDLILFTEAVNRWEITAIDHLPDYMKICFKALYDMTNEFSCKV YQKHGWNPLRSLKISWASLCNAFLVEAKWFASGQLPKSEEYLKNGIVSSGVNVGL VHMFFLLGQNITRKSVELLNETPAMISSSAAILRLWDDLGSAKDENQDGNDGSYV RCYLEEHEGCSIEEAREKTINMISDEWKKLNRELLSPNPFPATFTSASLNLAR,MIP LMYSYD GNQSLPSLKEYMKLMLYETVSM INFORMATION FOR NO: 5A (H64NORD1/W155) SEQUENCE CHARACTERISTICS: LENGTH: 333 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Includes stop codon and an intron. SEQUENCE DISCRIPTION FOR NO: 5A CTCCCACAGCTTCTTAGTTGCTGATCATAGATCAGATGGCATCGTCTTCTCGGGC CTTCTTTAAAGTATTCAATCCTCAAATTGCCTGCTACTTTTGAGATAGCTTGCTTC CCAGTTCTATTACTATAAAGCCGATGAACGTTGAAACCAAGCATACTAGAACTAT GGTAAAATTCTCGGAGCTTTCTCCGAAGTACATTTCTACAAA.AGGGTAGAGCTAG CTACTAAACAATAGTTAATTGACTGTGCCTTGCTTGCAGGGTGACATTTTTGTCCA ACATTCTCAGAAGTTGGAACTATTGAAAACTGTCTTGAGGAATGTAGCAGAGCTA G INFORMATION FOR .NO: 5B (H64NORD1/W155) SEQUENCE CHARACTERISTICS: LENGTH: 240 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Stop codon modified and intron removed. SEQUENCE DISCRIPTION FOR NO: 5B CTCCCACAGCTTCTTAGTTGCTGATCATAGATCAGATGGCATCGTCTTCTCGGGC CTTCTTTAAAGTATTCAATCCTCAAATTGCCTGCTACTTTCTAGATAGCTTGCTTC CCAGTTCTATTACTATAAAGCCGATGAACGTTGAAACCAAGCATACTAGAACTAT GGGTGACATTTTTGTCCAACATTCTCAGAAGTTGGAACTATTGAA.A.ACTGTCTTG AGGAATGTAGCAGAGCTAG SO INFORMATION FOR NO: 5C (H64NORD1/W155) SEQUENCE CHARACTERISTICS: LENGTH: 68 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Stop codon modified and intron removed and fragment translated. SEQUENCE DISCRIPTION FOR NO: 5C MASSSRAFFKVFNPQIACYFLDSLLPSSITIKPMNVETKHTRTMGDIFUQHSQKLE LLKTVLRNVAEL INFORMATION FOR NO: 6A (H64NORU1/W151) SEQUENCE CHARACTERISTICS: LENGTH: 392 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragmeht from the 5' of cultivated strawberry H64. Includes stop codon and an intron. SEQUENCE DISCRIPTION FOR NO: 6A CTCCCACAGCTTCTTAGTTGCTGATCATAGATCAGATGGCATAGTCTTTTCGGTC CCTCTTTAAAGTATTCAATCAAATTGCTCCAA.AAATTATCTCACATGTTGGCCACT CTAAGAAGCAGCTGCCTGCTACTTTTCAAAGATGGGGCGTTGCCGAAGATAGCTT GCTTTCCAGTTCTAGTACTATAAAGCTGATGAACGTTGAAACCAAGCATACTAGA ACTATGGTAA.AATTCTTGGGGCTTTCTCCTACGTACATTTCTTCAATGAGGCTAGC TAGCTACTAAACAATAGTTAATTGACTGTGCCTTACTTGCAGGATGACATTTTTGT CCAACATTCTCGGAAGCTGGAACTACTCAGGAATGTCTTGAGGAATGTAGCAGAG CTAG INFORMATION FOR NO: 6B (H64NORU1/W151) SEQUENCE CHARACTERISTICS:LENGTH: 300 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Stop codon modified and intron removed. SEQUENCE DISCRIPTION FOR NO: 6B CTCCCACAGCTTCTTAGTTGCTGATCATAGATCAGATGGCAAAGTCTTTTCGGTC CCTCTTTAAAGTATTCAATCAAATTGCTCCAAAAATTATCTCACATGTTGGCCACT CTAAGAAGCAGCTGCCTGCTACTTTTCAAAGATGGGGCGTTGCCGAAGATAGCTT GCTTTCCAGTTCTAGTACTATAAAGCTGATGAACGTTGAAACCAAGCATACTAGA ACTATGGATGACATTTTTGTCCAACATTCTCGGAAGCTGGAACTACTCAGGAATG TCTTGAGGAATGTAGCAGAGCTAG INFORMATION FOR NO: 6C (H64NORU1/W151) SEQUENCE CHARACTERISTICS: LENGTH:88 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Stop codon modified and intron removed and fragment translated SEQUENCE DISCRIPTION FOR NO: 6C MAKSFRSLFKVFNQIAPKIISHVGHSKKQLPATFQRWGVAEDSLLSSSSTIKLMNV ETKHTRTMDDIFVQHSRKLELLRNVLRNVAEL INFORMATION FOR NO: 7A (H64NORU2/UP3) SEQUENCE CHARACTERISTICS: LENGTH: 350 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Includes stop codon and an intron. SEQUENCE DISCRIPTION FOR NO: 7A CTCCCACAGCTTCTTAGTTGCTGATCATAGATCAGATGGCATAGTCTTTTCGGTC CCTCTTTAAAGTATTCAATCAAATTGCTCCAAAAATTATCTCACATGTTGGCCACT CTAAGAAGCAGCTGCCTGCTACTTTTCAAAGATGGGGCGTTGCCGAAGATAGCTT GCTTTCCAGTTCTAGTACTATAAAGCTGATGAACGTTGAAACCGAGCATACTAGA ACTATGGTAAAATTCTTGGGGCTTTCTCCTACGTACATTTCTTCAATGAGGCTAGC TAGCTACTAAACAATAGTTAATTGACTGTGCCTTACTTGCAGGATGACATTTTTGT CCAACATTCTCGGAAGC INFORMATION FOR NO: 7B (H64NORU2/UP3) SEQUENCE CHARACTERISTICS: LENGTH:258 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Stop codon modified and intron removed. SEQUENCE DISCRIPTION FOR NO: 7B CTCCCACAGCTTCTTAGTTGCTGATCATAGATCAGATGGCAA.AGTCTTTTCGGTC CCTCTTTAAAGTATTCAATCAAATTGCTCCAAAAATTATCTCACATGTTGGCCACT CTAAGAAGCAGCTGCCTGCTACTTTTCAAAGATGGGGCGTTGCCGAAGATAGCTT GCTTTCCAGTTCTAGTACTATAAAGCTGATGAACGTTGAAACCGAGCATACTAGA ACTATGGATGACATTTTTGTCCAACATTCTCGGAAGC INFORMATION FOR NO: 7C (H64NORU2/UP3) SEQUENCE CHARACTERISTICS: LENGTH: 74 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Stop codon modified and intron removed and fragment translated SEQUENCE DISCRIPTION FOR NO: 7C MAKSFRSLFKVFNQIAPKIISHVGHSKKQLPATF~,1RWGVAEDSLLSSSSTIKLMNV ETEHTRTMDDIFVQHSRK INFORMATION FOR NO: 8A (H64NORU3/UP16) SEQUENCE CHARACTERISTICS: LENGTH: 367 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Includes an intron. SEQUENCE DISCRIPTION FOR NO: 8A CTCCCACAGCTTCTTAGTTGCTGATCATAGATCAGATGGCATCGTCTTCTCGGGC CTTCTTTAAAGTATTCAATCCTGCTCCAAAAAGCATCCCACGTATTGGCCAGTCTA ACCTCATGCAGCTTACACATAAGAAGCAGCTGCCTACTTTTCAAAGACGGGGCAT TGCCGAAGATAGCTTGCTTCCCAGTTCTACTACTCCCATAAAGCTGATGAACGTT GAAACCAAGCATACTAGAACTATGGTAAA.ATTCTCGGAGCTTTCTCCGAAGTACA TTTCATCAAGAGGCTAGCTATAGCTACTACACAATAGTTTGACTGTGCCTTGCTT GCAGGGTGACATTTTTGTCCAACATTGTCAGAAGTT INFORMATION FOR NO: 8B (H64NORU3/UP16) SEQUENCE CHARACTERTSTICS: LENGTH: 277 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Intron removed. SEQUENCE DISCRIPTION FOR NO: 8B CTCCCACAGCTTCTTAGTTGCTGATCATAGATCAGATGGCATCGTCTTCTCGGGC CTTCTTTAAAGTATTCAATCCTGCTCCAAAAAGCATCCCACGTATTGGCCAGTCTA ACCTCATGCAGCTTACACATAAGAAGCAGCTGCCTACTTTTCAAAGACGGGGCAT TGCCGAAGATAGCTTGCTTCCCAGTTCTACTACTCCCATAAA.GCTGATGAACGTT GAAACCAAGCATACTAGAACTATGGGTGACATTTTTGTCCAACATTGTCAGAAGT T INFORMATION FOR NO: 8C (H64NORU3/UP16) SEQUENCE CHARACTERISTICS: LENGTH: 80 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Intron removed and fragment translated SEQUENCE DISCRIPTION FOR NO: 8C MASSSRAFFKVFNPAPKSIPRIGQSNLMQLTHKKQLPTFQRRGIAEDSLLPSSTTPIKLMNVETKHTRTMGDIFVQHCQK TNFORMATION FOR NO: 9A (H64NORU4/UP1) SEQUENCE CHARACTERISTICS: LENGTH: 357 5 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Includes an intron.10 SEQUENCE DISCRIPTION FOR NO: 9A CTCCCACAGCTTCTTAGTTGCTGATCATAGATCAGATGGCATCGTCTTCTCGGGC CTTCTTTAAAGTATTCAATCCTGCTCCAAAAAGCATCCCACGTATTGGCCAGTCTA ACCTCATGCAGCTTACACATAAGAAGCAGCTGCCTACTTTTCAAAGACGGGGCAT GAAACCAAGCATACTAGAACTATGGTAA.AATTCTCGGAGCTTTCTCCGAAGTACA TTTCATCAAGAGGCTAGCTATAGCTACTACACAATAGTTTGACTGTGCCTTGCTT GCAGGGTGACATTTTTGTCCAACATT20 INFORMATION FOR NO: 9B (H64NORU4/UP1) SEQUENCE CHARACTERISTICS: LENGTH: 267 TYPE: Genomic DNA STRANDNESS: Single 25 TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Intron removed. SEC-~UENCE DTSCRIPTION FOR NO: 9B CTTCTTTAAAGTATTCAATCCTGCTCCAAAAAGCATCCCACGTATTGGCCAGTCTA ACCTCATGCAGCTTACACATAAGAAGCAGCTGCCTACTTTTCAAAGACGGGGCAT TGCCGAAGATAGCTTGCTTCCCAGTTCTACTACTCCCATAAAGCCGATGAACGTT GAAACCAAGCATACTAGAACTATGGGTGACATTTTTGTCCAACATT INFORMATION FOR NO: 9C (H64NORU4/UP1) SEQUENCE CHARACTERISTICS: LENGTH: 77 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: PCR fragment from the 5' of cultivated strawberry H64. Intron removed and fragment translated SEQUENCE DISCRIPTION FOR NO: 9C MASSSRAFFKVFNPAPKSIPRIG~SNLMQLTHKKQLPTFQRRGIAEDSLLPSSTTPI KPMNVETKHTRTMGDIFVNI INFORMATION FOR NO: 10A (SOSA/WS) SEQUENCE CHARACTERISTICS: LENGTH: 1672 TYPE: cDNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY OLEFIN SYNTHASE. INCLUDES A STOP CODON. SEQUENCE DISCRIPTION FOR NO: 10A ATGCCTGTCCATGCTACTCCAGCAGCTGAATCCCAGATCATCTCTATGCCGGAAG TTGTTCGGCGCACAGCAAATTTTAAACCTAGCGTTTGGGGAGATCGGTTTGCTAA CTATGCCGAAGACATTATAACTCAAACTCAAATGCAAGAACAAGTTGAGGAGCTG AAACAAGTGAGGAAGGAAGTATTCACTAATGCTGCTGATGATTCTTCACATCAAC TGAAGCCAATTGATGAAATCCAGCGCCTCGGTGTGGCTTACCATTTCGAAAGCGA AATAGATCAAGCCCTGGAACGTATACATGAGACATATCAAGATATTCATGATGGT GGTGATCTGTACAATGTTGCTCTTCGTTTTCGGCTACTCAGGCGACATGGATATA ATGTTTCCTGCGATGTATTCAACAAGTTCAAAGATACTAATGGTGACTACAAGAA AAGCTTGGTCACTGATCTTTCTGGTATGCTGAGCTTTTATGAGGCGGCCCATCTG AGGGTGCATGGAGAAAA.ATTACTTGAAGAGGCTCTGGTTTTTACCACCACTCATC TCCAGTCAGCAAGTGCAAAAAGCTCTTTGCTGAAAACACAAATAACTGAAGCCGT AGAGAGACTACTAAAAACTATGGAGAGGTTAGGTGCTCGGCGTTACATGTCAATA TATCAAGATGAAGCTTCATACAGTGAA.AATTTACTGAAACTTGCAA.A.ATTAGATTT TAATGTTGTTCAGTGTTTACACAAAA.AGGAACTCAGTGACATTCCCTAAGATGGT ACAAGGAACTGGACTTTGCAAGGAGGATGCCTTTTGCTCGAGATAGGATCGTGG AGTTGTTCTTTTGGATAGCAGGAATATATTTCGAACCTGAATACGTCTTTAGGAG ACACATTCTGACTAAACTGATTGAGATAACAACAGTAATGGATGATATGTATGAT GCATTCGGTACATTCGAAGAACTCGTCAACTTGACTGAAGCAATTGACAGGTGGG ATGCAAGTTGCATGGATCAACTGCCAGACTATATGCAACCATTTTATATTACACTT CTGGATGTTATCGATGAAGTTGAAGAGGAGCTGACAAAGCAAGGAAGATCTTAC CGAATTCACTACGCAAAAGAAATTATGAAGAATCAAGCCAGGCTCTACTTCGCTG AGGCCAGATGGTTCCACGAAGGATGCACCCCAAAA.ATGGATGAGTATATGCGAG TTGCGGCATCTTCTGTCGGTAACACCATGCTTTCCGTCGTGTCTTTAGTAGGCAT GGGAGACATTATAACA.A,AATTTGAATTCGAGTGGCTGACCAATGAGCCTAAAATC CTTAGAGCTTCGAATACCATATTTAGGCTTATGGATGACATTGCTGGGTACAAGT TTGAGAAAGAGAGAGGGCATGTTGCTTCAAGTATTGATTGCTACATGAATGAATA CGGGGTTTCAGAGCAAGAGACAATTGATATCTTCAACAAACGAATTGTGGATTCG TGGAAGGATATAAACGAAGAGTTTCTGAGACCCACTGCTGCTCCAGTCCCTGTGC TTAATCGTGTTCTTAACCTAACCCGAGTGGTTGATCTGCTTTACAAAAGGGGAGA TGCCTTCACGCATGTCGGAAAACTGATGAAAGATTGTATTGCTGCAATGTTTATT GATCCAGTGCCACTCTGAACTCA INFORMATION FOR NO: lOB (SOSA/WS) SEQUENCE CHARACTERISTICS: LENGTH: 254 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY OLEFIN SYNTHASE. SEQUENCE DISCRIPTION FOR NO: 10B 8g MPVHATPAAESQIISMPEVVRRTANFKPSVWGDRFANYAEDIITQTQMQEQVEEL KQVRKEVFTNAADDSSHQLKPIDEIQRLGVAYHFESEIDQALERIHETYQDIHDGG DLYNVALRFRLLRRHGYNVSCDVFNKFKDTNGDYKKSLVTDLSGMLSFYEAAHL RVHGEKLLEEALVFTTTHLQSASAKSSLLKTQITEAVERLLKTMERLGARRYMSIY QDEASYSENLLKhAKLDFNVVQCLHKKELSDIP INFORMATION FOR NO: lOC (SOSA/WS) SEQUENCE CHARACTERISTICS: LENGTH:554 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY OLEFIN SYNTHASE. Deleting the CC insertion SEQUENCE DISCRIPTION FOR NO: 10C MPVHATPAAESQIISMPEVVRRTANFKPSVWGDRFANYAEDIITQTQMQEQVEEL KQVRKEVFTNAADDSSHQLKPIDEIQRLGVAYHFESEIDQALERIHETYQDIHDGG DLYNVALRFRLLRRHGYNVSCDVFNKFKDTNGDYKKSLVTDLSGMLSFYEAAHL RVHGEKLLEEALVFTTTHLQSASAKSSLLKTQITEAVERLLKTMERLGARRYMSIY QDEASYSENLLKLAI~LDFNWQCLHKKELSDILRWYI~ELDFARRMPFARDRIVEL FFWIAGIYFEPEYVFRRHILTKLIEITTVMDDMYDAFGTFEELVNLTEAIDRWDAS C MDQLPDYMQPFYITLLDVIDEVEEELTKQGRSYRIHYAKEIMKNQARLYFAEARW FHEGCTPKMDEYMRVAASSVGNTMLSVVSLVGMGDIITKFEFEWLTNEPKILRAS NTIFRLMDDIAGYKFEKERGHVASSIDCYMNEYGVSEQETIDIFNKRIVDSWKDIN EEFLRPTAAPVPVLNRVLNLTRV VDLLYKRGDAFTHVGKLMKD CIA.AMFIDPVPL INFORMATION FOR NO: 11A (SOSA/MA) SEQUENCE CHARACTERISTICS: LENGTH: 2605 TYPE: cDNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY OLEFIN SYNTHASE. INCLUDES A STOP CODON. SEQUENCE DISCRIPTION FOR NO: ilA CTAATACGACTCACTATAGGGCAAGCAGTGGTAACAACGCAGAGTACGCGGGGA CATTTGATTCATAGTTATTAGATTGTGTTTTTCCGTCCAGTTAGGTTTAAGGATTA TACACTCGTTTAATGTATTGTTAGAACGGTGATTGTGTGCTTAGTTAATAGATTTT GCTTTTATTCAAGAGCGTAGGGTTCAATTTGAGTATGCATGTTCTTTTATCTTTAG CTTTTATTATGGAATTTTTATAA.A.ATGTTATAATATTAATTTCTTAATGAGTAGTTA AATTACGTGATTATTTGATTTTTTTAATCTAAAATGTGATATGTA.A.A.ATATAGAAG TTTAA.A.AACTTTCAGAAATTTTTTAAATTCTTTTAGCCCACCCAAACC TAAA.ATCCTAGGTCCGCCGTCGATGCAAAGTACAAATAGAAACATGTCTTTCTCA GTCATGAATCATGTCATCATGATATTGATAGATGATGTCGTTTAGCAATAAAGGG CTGTTCTGCGGTTAAAATATAAACATCTTCCGATCTTATTATTTACAACAACAAAA AATCTTCCAAACTCAATTATCAGCATCTGTATCAGATCTGCATGGAGTCCCCTATA AATATATGATCATAGCAGCAATATACTTCATACTTGAAGAAA.A.AGCTATAGCTAG TCCACAAGTGCAGAAAGTTAATCATGCCTGTCCATGCTACTCCAGCAGCTGAATC CCAGATCATCTCTATGCCGGAAGTTGTTCGGCGCACAGCAAATTTTAAACCTAGC GTTTGGGGAGATCGGTTTGCTAACTATGCCGAAGACATTATAACTCAAACTCAAA TGCAAGAACAAGTTGAGGAGCTGAAACAAGTAGTGAGGAAGGAAGTATTCACTA ATGCTGCTGATGATTCTTCACATCAACTGAAGCTAATTGATGAAATCCAGCGCCT CGGTGTGGCTTACCATTTCGAAAGCGAAATAGATCAAGCCCTGGAACGTATACAT GAGACATATCAAGATATTCATGATGGTGGTGATCTGTACAATGTTGCTCTTCGTT TTCGGCTACTCAGGCGACATGGATATAATGTTTCCTGCGATGTATTCAACAAGTT CAAAGATACTAATGGTGACTACAAGAAAAGCTTGGTCACTGATCTTTCTGGTATG CTGAGCTTTTATGAGGCGGCCCATCTGAGGGTGCATGGAGAAA.A.ATTACTTGAAG AGGCTCTGGTTTTTACCACCACTCATCTCCAGTCAGCAAGTGCAA.A.A.A.GCTCTTT GCTGAA.A.ACACAA.ATAACTGAAGCCGTAGAGAGACTACTAAAA.ACTATGGAGAG GTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCATACAGTGAA AATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACAA.A.A.A. ATGCCTTTTGCTCGAGATAGGATCGTGGAGTTGTTCTTTTGGATAGCAGGAATAT ATTTCGAACCTGAATACGTCTTTAGGAGACACATTCTGACTAAACTGATTGAGAT AACAACAGTAATGGATGATATGTATGATGCATTCGGTACATTCGAAGAACTCGTC AACTTGACTGAAGCAATTGACAGGTGGGATGCAAGTTGCATGGATCAACTGCCA GGAGCTGACAAAGCAAGGAAGATCTTACCGAATTCACTACGCAA.AAGAAATTATG AAGAATCAAGCCAGGCTCTACTTCGCTGAGGCCAGATGGTTCCACGAAGGATGC ACCCCA.AAAATGGATGAGTATATGCGAGTTGCGGCATCTTCTGTCGGTAACACCA TGCTTTCCGTCGTGTCTTTAGTAGGCATGGGAGACATTATAACAAAATTTGAATT CTTATGGATGACATTGCTGGGTACAAGTTTGAGAAAGAGAGAGGGCATGTTGCTT CAAGTATTGATTGCTACATGAATGAATACGGGGTTTCAGAGCAAGAGACAATTGA TATCTTCAACAAACGAATTGTGGATTCGTGGAAGGATATAAACGAAGAGTTTCTG AGACCCACTGCTGCTCCAGTCCCTGTGCTTAATCGTGTTCTTAACCTAACCCGAG20 TGGTTGATCTGCTTTACAA.A.AGGGGAGATGCCTTCACGCATGTCGGAA.A.ACTGAT GAAAGATTGTATTGCTGCAATGTTTATTGATCCAGTGCCACTCTGAACTCATCGG ATCAGTCATCACATTCAGTCTCCTGATGCTAGCGTTTGCTTTTTATTTGAATGTATTCTTGAATAAGACGATGCACCTCGATCAATTTGTGCTTCAGTGTTTCACGTACTG ATGAGTCCTATCCTTTCTAGAAGAGGAACATCAATGTTGGTTTGCTAATAAAGCT2~ TTATTGTTTGAATGTCGGGTTGATAATTCTTAACTAATTATGTTGTCT s1 INFORMATION FOR NO: 11B (SOSA/MA) SEQUENCE CHARACTERISTICS: LENGTH: 255 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY OLEFIN SYNTHASE. SEQUENCE DISCRIPTION FOR NO: 11B MPVHATPAAESQIISMPEVVR,RTANFKPSVWGDRFANYAEDIITQTQMQEQVEEL KQVVRKEVFTNAADDSSHQLKLIDETQRLGVAYHFESEIDQALERIHETYQDIHDG GDLYNVALRFRLLRRHGYNVSCDVFNKFKDTNGDYKKSLVTDLSGMLSFYEAAH LRVHGEKLLEEALVFTTTHLQSASAKSSLLKTQITEAVERLLKTMERLGARRYMSI YQDEASYSENLLKLAKLDFNWQCLHKKELSDIP TNFORMATION FOR NO: 11C (SOSA/MA) SEQUENCE CHARACTERISTICS: LENGTH: 555 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY OLEFIN SYNTHASE. Deleting the CC insertion. SEQUENCE DISCRIPTION FOR NO: 11C MPVHATPAAESQIISMPEVVRRTANFKPSVWGDRFANYAEDIITQTQMQEQVEEL KQVVRKEVFTNAADDSSHQLKLIDEIQRLGVAYHFESEIDQALERIHETYQDIHDG GDLYNVALRFRLLRRHGYNVSCDVFNKFKDTNGDYKKSLVTDLSGMLSFYEAAH LRVHGEKLLEEALVFTTTHLQSASAKSSLLKTQITEAVERLLKTMERLGARRYMSI YQDEASYSENLLKLAKLDFNVVQCLHKKELSDILRWYKELDFARRMPFAR,DRIVE LFFWIAGIYFEPEYVFRRHILTKLIEITTVMDDMYDAFGTFEELVNLTEAIDRWDASCMDQLPDYMQPFYITLLDVIDEVEEELTKQGRSYRIHYAKEIMKNQARLYFAEAR WFHEGCTPKMDEYMRVAASSVGNTMLSVVSLVGMGDIITKFEFEWLTNEPKILRA SNTIFRLMDDIAGYKFEKERGHVASSIDCYMNEYGVSEQETIDIFNKR,TVDSWKDI NEEFLRPTAAPVPVLNRVLNLTRVVDLLYKRGDAFTHVGKLMKDCTAAMFIDPVP L INFORMATION FOR NO: 12A (SOSV) SEQUENCE CHARACTERISTICS: LENGTH: 1973 TYPE: cDNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: WILD STRAWBERRY OLEFTN SYNTHASE SEQUENCE DISCRIPTION FOR NO: 12A ATGGCTGTCCATGCTACTCCAGCAGCTGAATCCCAGATCATCTCTAAGCCGGAAG TTGTTCGGCGCACAGCAAATTTTAAACCTAGCGTTTGGGGAGATCGGTTTGCTAA CTATGCCGAAGACATTATAACTCAAACTCAAATGCAAGAACAAGTTGAGGAGCTG AAACAAGTAGTGAGGAAGGAAGTATTCACTAATGCTGCTGATGATTCTTCACATC AACTGAAGCTAATTGATGAAATCCAGCGCCTCGGTGTGGCTTACCATTTCGAAAG CGAAATAGATCAAGCCCTGGAACGTATACATGAGACATATCAAGATATTCATGAT GGTGGTGATCTGTACAATGTTGCTCTTCGTTTTCGGCTACTCAGGCGACATGGAT ATAATGTTTCCTGCGATGTATTCAACAAGTTCAAAGATACTAATGGTGACTACAA GAA.AAGCTTGGTCACTGATCTTTCTGGTATGCTGAGCTTTTATGAGGCGGCCCAT CTGAGGGTGCATGGAGAAAAATTACTTGAAGAGGCTCTGGTTTTTACCACCACTC ATCTCCAGTCAGCAAGTGCAAAAAGCTCTTTGCTGAAAACACAAATAACTGAAGC CGTAGAGAGACCTCTACTAAAAACTATGGAGAGGTTAGGTGCTCGGCGTTACATG TCAATATATCAAGATGAAGCTTCATACAGTGAAAATTTACTGAAACTTGCAA.AATT AGATTTTAATGTTGTTCAGTGTTTACACAA.AA.AGGAACTCAGTGACATTCTAAGAT GGTACAAGGAACTGGACTTTGCAAGGAGGATGCCTTTTGCTCGAGATAGGATCG TGGAGTTGTTCTTTTGGATAGCAGGAATATATTTCGAACCTGAATACGTCTTTGG GAGACACATTCTGACTAAACTGATTGAGATAACAACAGTAATGGATGATATGTAT GATGCATTCGGTACATTCGAAGAACTCGTCATCTTGACTGAAGCAATTGACAGGT GGGATGCAAGTTGCATGGATCAACTGCCAGACTATATGCAACCATTTTATATAAC ACTTCTGGATGTTATCGATGAAGTTGAAGAGGAGCTGACAAAGCAAGGAAGATCT TACCGAATTCACTACGCAAAAGAAATTATGAAGAATCAAGCCAGGCTCTACTTCG CTGAGGCCATATGGTTCCACGAAGGATGCACCCCAAAAATGGATGGGTATATGC GAGTTGCGGCATCTTCTGTCGGTAACACCATGCTTTCCGTCGTGTCTTTAGTAGG CATGGGAGACATTATAACAAAATTTGAATTCGAGTGGCTGACCAATGAGCCTAAA ATCCTTAGAGCTTCGAATACCATATTTAGGCTTATGGATGACATTGCTGGGTACA AGTTTGAGAAAGAGAGAGGGCATGTTGCTTCTAGTATTGATTGCTACATGAATGA ATACGGGGTTTCAGAGCAAGAGACAATTGATATCTTCAACAAACGAATTGTGGAT TCGTGGAAGGATATAAACGAAGAGTTTCTGAGACCCACTGCTGCTCCAGTCCCTG TGCTTAATCGTGTTCTTAACCTAACCCGAGTGGTTGATCTGCTTTACAAAAGGGG AGATGCCTTCACGCATGTCGGAAAACTGATGAAAGATTGTATTGCTGCAATGTTT ATTGATCCAGTGCCACTCTGAACTCATCGGATCAGTCATCACATTCAGTCTCCTG ATGCTAGCGTTTGCTTTTTATTTGAATGTATTCTTGAATAAGACGATGCACCTCGA TCAATTTGTGCTTCAGTGTTTCACGTACTGATGAGTCCTATCCTTTCTAGAAGAG GAACATCAATGTTGGTTTGCTAATAAAGCTTTATTGTTTGAATGTCGGGTTGATA ATTCTTAACTAATTATGTTGTCTACTTTGTACTTTCAAACTCAATCTCAATACAGA ATTTATAGTGTACGAACT INFORMATION FOR NO: 12B (SOS SEfIUENCE CHARACTERISTICS: LENGTH: 556 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: WILD STRAWBERRY OLEFIN SYNTHASE SEQUENCE DISCRIPTION FOR NO: 12B MPVHATPAAESQIISKPEVVRRTANFKPSVWGDRFANYAEDIITQTQMQEQVEELK QVVRKEVFTNAADDSSHQLKLIDEIQRLGVAYHFESEIDQALERIHETYQDIHDGG DLYNVALRFRLLRRHGYNVSCDVFNKFKDTNGDYKKSLVTDLSGMLSFYEAAHL RVHGEKLLEEALVFTTTHLQSASAKSSLLKTQITEAVERPLLKTMERLGARRYMSI YQDEASYSENLLKLAKLDFNVVQCLHKKELSDILRWYKELDFARRMPFARDRIVE LFFWIAGIYFEPEYVFGRHILTKLIEITTVMDDMYDAFGTFEELVILTEAIDRWDAS CMDQLPDYMQPFYTTLLDVIDEVEEELTKQGRSYRIHYAKEIMKNQARLYFAEAIW FHEGCTPKMDGYMRVAASSVGNTMLSVVSLVGMGDIITKFEFEWLTNEPKILRAS NTIFRLMDDIAGYKFEKERGHVASSIDCYMNEYGVSEQETIDIFNKR,IVDSWKDINEEFLRPTAAPVPVLNRVLNLTRWDLLYKR,GDAFTHVGKLMI~D CIAAMFIDPVPL INFORMATION FOR NO: 13A (SOSV1/W76) SEQUENCE CHARACTERISTICS: LENGTH:2~9 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of wild strawberry. Including an intron. SEQUENCE DISCRIPTION FOR NO: 13A AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCATACAG TGAAAATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA AAA.AGGAACTCAGTGACATTCTAAGGTAAATTAAGCCATCGATCTTATAGTTAAT TAGTATATACATATACAAGATAAGTTATAACCTAATATTGTTCTAAATATACTAGA TGGTACAAGGAACTGGACTTTGCAAGGAGGATGCCTTTTGCTCGAGATAGGATC GTGGAGTTGTTCT INFORMATION FOR NO: 13B (SOSV1/W76) SEQUENCE CHARACTERISTICS: LENGTH: 204 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of wild strawberry. Not including an intron. SEQUENCE DISCRIPTION FOR NO: 13B AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCATACAG TGAA.AATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA A A_A_A_GGAACTCAGTGACATTCTAAGATGGTACAAGGAACTGGACTTTGCAAGGA GGATGCCTTTTGCTCGAGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 13C (SOSV1/W76) SEQUENCE CHARACTERISTICS: LENGTH: 67 TYPE: Peptide 10 STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Translation of fragment from PCR on genomic DNA of wild strawberry. SEQUENCE DISCRIPTION FOR NO: 13C RLGARRYMSIYQDEASYSENLLKLAKLDFNWQCLHKKELSDILRWYKELDFARR MPFARDRIVELF INFORMATION FOR NO: 14A (SOSV2/W93) SEQUENCE CHARACTERISTICS: LENGTH: 289 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of wild strawberry. Including an intron. SEQUENCE DISCRIPTION FOR NO: 14A AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCATACAGTGAAA.ATTTACTGAAACTTGCAA.A.ATTAGATTTTAATGTTGTTCAGTGTTTACACA A.A.AAGGAACTCAGTGACATTCTAAGGTAAATTAAGCCATCGATCTTATAGTTAAT TAGTATATACATATACAAGATAAGTTATAACCTAATATTGTTCTAAATATACTAGA TGGTACAAGGAACTGGACTTTGCAAGGAGGATGCCCTTTGCTCGAGATAGGATC GTGGAGTTGTTCT INFORMATION FOR NO: 14B (SOSV2/W93) SEQUENCE CHARACTERISTICS: LENGTH: 204 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of wild strawberry. Not including an intron. SEQUENCE DISCRIPTION FOR NO: 14BAGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCATACAG TGAAAATTTACTGAAACTTGCAA.AATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGACATTCTAAGATGGTACAAGGAACTGGACTTTGCAAGGA GGATGCCCTTTGCTCGAGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 14C (SOSV2/W93) SEQUENCE CHARACTERISTICS: LENGTH: 67 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Translation of fragment from PCR on genomic DNA of wild strawberry. SEQUENCE DISCRIPTION FOR NO: 14C RLGARRYMSIYQDEASYSENLLKLAI~LDFNWQCLHKKELSDILRWYKELDFARR MPFARDRIVELF INFORMATION FOR NO: 15A (SOSV3/W90) SEQUENCE CHARACTERISTICS: LENGTH: 300 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of wild strawberry. Including an intron. SEQUENCE DISCRIPTION FOR NO: 15A AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAAA.ATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGACATTCTAAGGTAAACTAAGCCATCGATCTTATAGCTATT AGTTGTATGTATATGTATACAAGATAAGTAATAACCTTCTAATATTGCTCTATATA I~ CTATATATAGATGGTATAAGGAACTGGACTTTGCAAGGAGGATGCCTTTTGCACG AGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 15B (SOSV3/W90) SEQUENCE CHARACTERISTICS: LENGTH:204 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of wild strawberry. Not including an intron. SEQUENCE DISCRIPTION FOR NO: 15BAGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAA.AATTTACTGAAACTTGCAA.AATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGACATTCTAAGATGGTATAAGGAACTGGACTTTGCAAGGAG GATGCCTTTTGCACGAGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 15C (SOSV3/W90) SEQUENCE CHARACTERISTICS: LENGTH: 67 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Translation of fragment from PCR on genomic DNA of wild strawberry. SEQUENCE DISCRIPTION FOR NO: 15C RLGARRYMSIYQDEASHSENLLKLAKLDFNWQCLHKKELSDILRWYKELDFARR MPFARDRIVELF INFORMATION FOR NO: 16A (SOSV4lW79) SEQUENCE CHARACTERISTICS: LENGTH: 289 TYPE: STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of wild strawberry. Including an intron. SEQUENCE DISCRIPTION FOR NO: 16A AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCATACAG TGAAAATTTACTGAAACTTGCAA.AATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGACATTCTAAGGTAAATTAGGCCATCGATCTTATAGTTAAT TAGTATATACATATACAAGATAAGTTATAACCTAATATTGTTCTAAATATACTAGA TGGTACAAGGAACTGGACTTTGCAAGGAGGATGCCTTTTGCTCGAGATAGGATC GTGGAGTTGTTCT INFORMATION FOR NO: 16B (SOSV4/W79) SEQUENCE CHARACTERISTICS: LENGTH: 204 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of wild strawberry. Not including an intron. SEQUENCE DISCRIPTION FOR NO: 16B AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCATACAG TGAA.AATTTACTGAAACTTGCAA.A.ATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGACATTCTAAGATGGTACAAGGAACTGGACTTTGCAAGGA GGATGCCTTTTGCTCGAGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 16C (SOSV4/W79) SEQUENCE CHARACTERISTICS: LENGTH: 67 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Translation of fragment from PCR on genomic DNA of wild strawberry. SEQUENCE DISCRIPTION FOR NO: 16C2~ RLGARRYMSIYQDEASYSENLLKLAKLDFNWQCLHKKELSDILRWYKELDFARR MPFARDRIVELF INFORMATION FOR NO: 17A (SOSV5/W84) SEQUENCE CHARACTERISTICS: LENGTH: 300 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of wild strawberry. Including an intron. SEQUENCE DISCRIPTION FOR NO: 17A AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAAAATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGACATTCTAAGGTAAACTAAGCCATCGATCTTATAGCTATT AGTTGTATATATATGTATACAAGATAAGTAATAACCTTCTAATATTGCTCTATATA CTATATATAGATGGTATAAGGAACTGGACTTTGCAAGGAGGATGCCTTTTGCACG AGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 17B (SOSV5/W84) SEQUENCE CHARACTERISTICS: LENGTH: 204 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of wild strawberry. Not including an intron. SEQUENCE DISCRIPTION FOR NO: 17B AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAAAATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGACATTCTAAGATGGTATAAGGAACTGGACTTTGCAAGGAG GATGCCTTTTGCACGAGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 17C (SOSVS/W84) SEQUENCE CHARACTERISTICS: LENGTH: 67 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Translation of fragment from PCR on genomic DNA of wild strawberry. SEQUENCE DISCRIPTION FOR NO: 17Cl0 RLGARRYMSIYQDEASHSENLLKLAKLDFNWQCLHKKELSDILRWYKELDFARR MPFARDRIVELF INFORMATION FOR NO: 18A (SOSA1/W66) SEQUENCE CHARACTERISTICS: LENGTH: 291 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Including an intron and a CC insertion. SEQUENCE DISCRIPTION FOR NO: 18A AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCATACAG TGAAA.ATTTACTGAAACTTGCAA.AATTAGATTTTAATGTTGTTCAGTGTTTACACA AAA.AGGAACTCAGTGACATTCCCTAAGGTAAATTAAGCCATCGATCTTATAGTTA ATTAGTATATACATATACAAGATAAGTTATAACCTAATATTGTTCTAAATATACTA GATGGTACAAGGAACTGGACTTTGCAAGGAGGATGCCTTTTGCTCGAGATAGGA TCGTGGAGTTGTTCT INFORMATION FOR NO: 18B (SOSAI/W66) SEQUENCE CHARACTERISTICS: LENGTH: 206 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Not including an intron. Including a CC insertion. SEfaUENCE DISCRIPTION FOR NO: 18B AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCATACAG TGAAA.ATTTACTGAAACTTGCAAA.ATTAGATTTTAATGTTGTTCAGTGTTTACACA AA_AA_GGAACTCAGTGACATTCCCTAAGATGGTACAAGGAACTGGACTTTGCAAGG AGGATGCCTTTTGCTCGAGATAGGATCGTGGAGTTGTTCTl5 INFORMATION FOR NO: 18C (SOSAliW66) SE(~UENCE CHARACTERISTICS: LENGTH: 67 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Translation of fragment from PCR on genomic DNA of cultivated strawberry. Deleted CC insertion SEQUENCE DISCRIPTION FOR NO: 18C RLGARRYMSIYQDEASYSENLLKLAKLDFNWQCLHKKELSDILRWYKELDFARR MPFARDRIVELF INFORMATION FOR NO: 19A (SOSA2/W68) SEQUENCE CHARACTERISTICS:LENGTH: 296 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Including an intron. SEQUENCE DISCRIPTION FOR NO: 19A AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAAAATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA_A_A_A_A_GGAACTCAGTGACATTCTAAGGTAAACTAAACAATCGATCTTATAGTTATT AGTTGTGTATGTATACAAGATACGCAATAACCATCTAATATTGCTCTATATATGTA CTATAGATGGTATAAGGAACTGGACTTTGCAAGGAGGATGCCTTTTGCTCGAGAT AGGATCGTGGAGTTGTTCTINFORMATION FOR NO: 19B (SOSA2/W68) SEQUENCE CHARACTERISTICS: LENGTH:204 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Not including an intron. SEQUENCE DISCRIPTION FOR NO: 19B AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAAA.ATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA AA.AAGGAACTCAGTGACATTCTAAGATGGTATAAGGAACTGGACTTTGCAAGGAG GATGCCTTTTGCTCGAGATAGGATCGTGGAGTTGTTCT l04 INFORMATION FOR NO: 19C (SOSA2/W68) SEQUENCE CHARACTERISTICS: LENGTH: 67 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Translation of fragment from PCR on genomic DNA of cultivated strawberry. SEQUENCE DISCRIPTION FOR NO: 19Cto RLGARRYMSIYQDEASHSENLLKLAKLDFNWQCLHKKELSDILRWYKELDFARR MPFARDRIVELF INFORMATION FOR NO: 20A (SOSA3/W46) SEQUENCE CHARACTERISTICS: LENGTH: 298 TYPE: Genomic DNA' STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Including an intron. SEQUENCE DISCRIPTION FOR NO: 20A 10~ AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGNAAAATTTACTCGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACA CAAA.AAGGAACTCAGTGACATTCTAAGGTAAACTAAACAATCGATCTTATAGTTA TTAGTTGTGTATGTATACAAGATACGCAATAACCATCTAATATTGCTCTATATATG TACTATAGATGGTATAAGGAACTGGACTTTGCAAGGAGGATGCCTTTTGCCCGAG ATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 20B (SOSA3/W46) SEQUENCE CHARACTERISTICS: LENGTH: 204 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Not including an intron.SEQUENCE DISCRIPTION FOR NO: 20B AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAA.A.ATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGACATTCTAAGATGGTATAAGGAACTGGACTTTGCAAGGAG GATGCCTTTTGCCCGAGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 20C (SOSA3/W46) SEQUENCE CHARACTERISTICS: LENGTH: 67 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Translation of fragment from PCR on genomic DNA of cultivated strawberry. SEQUENCE DISCRIPTION FOR NO: 20C RLGARRYMSIYQDEASHSENLLKLAKLDFNWQCLHKKELSDILRWYKELDFARR MPFARDRIVELF INFORMATION FOR NO: 21A (SOSA4/W59) SEQUENCE CHARACTERISTICS:(LENGTH: 296 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Including an intron. SEQUENCE DISCRIPTION FOR NO: 21A AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAAA.ATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGACATTCTAGGGTAAACTAAACAATCGATCTTATAGTTATTAGTTGTGTATGTATACAAGATACGCAATAACCATCTAATATTGCTCTATATATGTA CTATAGATGGTATAAGGAACTGGACTTTGCAAGGAGGATGCCTTTTGCTCGAGAT AGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 21B (SOSA4/W59) SEQUENCE CHARACTERISTICS: LENGTH: 204 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Not including an intron. SEQUENCE DISCRIPTION FOR NO: 21B AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAA.AATTTACTGAAACTTGCAA.AATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGACATTCTAGGATGGTATAAGGAACTGGACTTTGCAAGGA GGATGCCTTTTGCTCGAGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 21C (SOSA4/W59) SEQUENCE CHARACTERISTICS: LENGTH: 67 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Translation of fragment from PCR on genomic DNA of cultivated strawberry. SEQUENCE DISCRIPTION FOR NO: 21C RLGARRYMSIYQDEASHSENLLKLAKLDFNWQCLHKKELSDILGWYKELDFARR MPFARDRIVELF INFORMATION FOR NO: 22A (SOSAS/W74) SEQUENCE CHARACTERISTICS: LENGTH: 296 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Including an intron. SEQUENCE DISCRIPTION FOR NO: 22A AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGA.AAATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA AA.A.AGGAACTCAGTGACATTCTAAGGTAAACTAAACAATCGATCTTATAGTTATT AGTTGTGTATGTATACAAGATACGCAATAGCCATCTAATATTGCTCTATATATGTA CTATAGATGGTATAAGGAACTGGACTTTGCAAGGAGGATGCCTTTTGCTCGAGAT AGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 22B (SOSAS/W74) SEQUENCE CHARACTERISTICS: LENGTH: 204 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Not including an intron. SEQUENCE DISCRIPTION FOR NO: 22B AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAAAATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGACATTCTAAGATGGTATAAGGAACTGGACTTTGCAAGGAG GATGCCTTTTGCTCGAGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 22C (SOSA5/W74) SEQUENCE CHARACTERISTICS: LENGTH: 67 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Translation of fragment from PCR on genomic DNA of cultivated strawberry. SEQUENCE DISCRIPTION FOR NO: 22C RLGARRYMSIYQDEASHSENLLKLA.KLDFNWQCLHKKELSDILRWYI~ELDFARR MPFARDRIVELF INFORMATION FOR NO: 23A (SOSA6/W56) SEQUENCE CHARACTERISTICS: LENGTH: 302 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Including an intron. SEQUENCE DISCRIPTION FOR NO: 23AAGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAAA.ATTTACTGAAACTTGCAAA.ATTAGATTTTAATGTTGTTCAGTGTTTACACA_A_A_A_A_GGAACTCAGTGATATTCTAAGGTAAACTAAGCCATCGATCTTATAGCTATT AGTTGTATATATATGTATACAAGATAAGTAATAACCTTTTAATATTGCTCTATATA TACTATATATAGATGGTATAAGGAACTGGACTTTGCAAAGAGGATGCCTTTTGCT CGAGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 23B (SOSA6/W56) SEQUENCE CHARACTERISTICS: LENGTH: 204 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Not including an intron. SEQUENCE DISCRIPTION FOR NO: 23BAGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGA.AAATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGATATTCTAAGATGGTATAAGGAACTGGACTTTGCAAAGAG GATGCCTTTTGCTCGAGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 23C(SOSA6/W56) SEQUENCE CHARACTERISTICS: LENGTH: 67 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Translation of fragment from PCR on genomic DNA of cultivated strawberry. Not including an intron. SEQUENCE DISCRIPTION FOR NO: 23C RLGARRYMSIYQDEASHSENLLKLAI~LDFNW~QCLHKKELSDILRWYKELDFAKR MPFARDRIVELF INFORMATION FOR NO: 24A (SOSA7/W61) SEQUENCE CHARACTERISTICS: LENGTH: 302 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Including an intron. SEQUENCE DISCRIPTION FOR NO: 24A AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAAA.ATTTACTGAAACTTGCAAAATTAGATTTTAATGTTGTTCAGTGTTTACACA A.A.A.AGGAACTCAGTGACATTCTAAGGTAAACTAAGCCATCGATCTTATAGCTATT AGTTGTATATATATGTATACAAGATAAGTAATAACCTTCTAATATTGCTCTATATA TACTATATATAGATGGTATAAGGAACTGGACTTTGCAAGGAGGATGCCTTTTGCT CGAGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 24B (SOSA7/W61) SEQUENCE CHARACTERISTICS: LENGTH: 204 TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA of cultivated strawberry. Not including an intron. SEQUENCE DISCRIPTION FOR NO: 24B . AGAGGTTAGGTGCTCGGCGTTACATGTCAATATATCAAGATGAAGCTTCACACAG TGAAAATTTACTGAAACTTGCAAA.ATTAGATTTTAATGTTGTTCAGTGTTTACACA AAAAGGAACTCAGTGACATTCTAAGATGGTATAAGGAACTGGACTTTGCAAGGAG GATGCCTTTTGCTCGAGATAGGATCGTGGAGTTGTTCT INFORMATION FOR NO: 24C (SOSA7/W61) SEQUENCE CHARACTERISTICS: LENGTH: 67 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Translation of fragment from PCR on genomic DNA of cultivated strawberry. SEQUENCE DISCRIPTION FOR NO: 24C RLGARRYMSIYQDEASHSENLLI~.LAI~LDFNWQCLHKKELSDILRV'i~YKELDFARR MFFARDRIVELF INFORMATION FOR NO: 25A (H64TAR2) SEQUENCE CHARACTERISTICS: LENGTH: 1665 TYPE: cDNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY LTNALOOL/NEROLIDOL SYNTHASE WITH TARGET SIGNAL SEQUENCE DISCRIPTION FOR NO: 25A TCTAACCTCATGCAGCTTACACATAAGAAGCAGCTGCCTACTTTTCAAAGACGGG GCATTGCCGAAGATAGCTTGCTTCCCAGTTCTACTACTCCCATAAAGCCGATGAA CGTTGAAACCAAGCATACTAGAACTATGGGTGACATTTTTGTCCAACATTGTCAGAAGTTGGAACTATTCAGAAATGTCTTAAGGAATGTAGCAGAGCTAGATGCCCTTG AAGGTTTGAATATGATCGATGCTGTTCAAAGGCTAGGCATTGATTTCCACTTTCA ACGAGAAATCGATGAAATTCTGCACAAGCAAATGAGTAATGTATCTGCCTCTGAT GATCTTCATGAGGTTGCACTTCGCTTTCGACTACTGAGGCAACATGGTTACTTCGTGCCTGAAGATGTGTTTAACAACTTCAAGGACAGCAAAGGAACGTTCAAGCAAGT TCTGGGTGAAGACATCAAGGGATTGATGAGCTTATACGGAGCTTCGCAGCTAGG TACAGAAGGAGAAGATACACTTGTTGAAGCTGAAAAGTTTAGTGGCCATCTGCTA AAGACTTCTCTGTCACATCTTGATCATCATCATGCCAGAATTGTTGGCAATACATT GAGG.AATCCTCATCACAAAAGCTTGGCCTCATTCATGGCCAGGAACTTTTTCGTT ACTTCTCAAGCCACCAATTCATGGTTAAATTTGCTAAA.AGACGTAGCAAAA.ACAG ATTTCAATATGGTCCGGTCTCTGCATCAGAATGAAATAGTTCAAATTTCCAAATG GTGGAAGGAGCTTGGATTGGCTAAGGAACTGAAGTTTGCAAGAGATCAACCACA GAAATGGTACATTTGGTCCATGGCATGCCTAACAGATCCAAAGTTATCAGAGGAG AGGGTTGAGCTCACAAAACCCATTTCTTTTGTCTATTTGATAGATGACATTTTCGA TGTTTATGGAACTCTTGATGACCTCATTCTCTTCACAGAAGCTGTTAATAGATGG GAAATTACTGCTATAGACCACTTACCAGACTATATGAAGATATGCTTCAAGGCTC TCTATGATATGACTAATGAAATCAGCTGCAAGGTCTATCAGAAGCATGGATGGAACCCCTTACAATCTTTGAAAATTTCGTGGGCGAGTCTTTGCAATGCATTTTTGGTG GAAGCAAAATGGTTCGCATCTGGGCAGCTGCCGAAGTCAGAAGAGTACTTGAAG AACGGCATCGTTTCTTCTGGGGTTAATGTGGTTCTAGTCCACATGTTTTTTATCTT GGGTCAA.AACATAACCAGAAAGAGTGTGGAGTTGTTGAATGAAACTCCAGCCAT GATATCGTCCTCAGCAGCAATTCTTCGACTCTGGGACGATTTAGGCAGTGCAAAG GATGAGAACCAGGATGGGAACGATGGGTCGTATGTAAGGTGCTACTTAGAGGAA CATGAAGGCTGTTCCATTGAGGAGGCACGAGA,A.A.AGACGATTAATATGATTTCAG ATGAATGGAAGAAACTGAACAGAGAACTGCTCTCTCCAAATCCATTTCCAGCAAC AATCACATTGGCTTCTCTTAATCTCGCAAGAATGATCCCCTTGATGTATAGCTACG ATGGCAACCAATACCTTCCATCTCTTAAAGAGTATATGAAACTGATGTTGTATGA GACTGTATCAATGTAA INFORMATION FOR NO: 25B (H64TAR2) SEQUENCE CHARACTERISTICS: LENGTH: 554 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY LINALOOL/NEROLIDOL SYNTHASE WITH TARGET SIGNALSEQUENCE DISCRIPTION FOR NO: 25B SNLMQLTHKKQLPTFQRRGIAEDSLLPSSTTPIKPMNVETKHTRTMGDIFVQHCQ KLELFRNVLRNVAELDALEGLNMIDAVQRLGIDFHFQREIDEILHKQMSNVSASDDLHEVALRFRLLRQHGYFVPEDVFNNFKDSKGTFKQVLGEDIKGLMSLYGASQL GTEGEDTLVEAEKFSGHLLKTSLSHLDHHHARIVGNTLRNPHHKSLASFMARNFF VTSQATNSWLNLLKDVAKTDFNMVRSLHQNEIVQISKWWKELGLAKELKFARDQ PQKWYIWSMACLTDPKLSEERVELTKPISFVYLIDDIFDVYGTLDDLILFTEAVNR WEITAIDHLPDYMKICFKALYDMTNEISCKVYQKHGWNPLQSLKISWASLCNAFL VEAKWFASGQLPKSEEYLKNGIVSSGVNVVLVHMFFILGQNITRKSVELLNETPA MISSSAAILRLWDDLGSAKDENQDGNDGSYVRCYLEEHEGCSIEEAREKTINMISD EWKKLNRELLSPNPFPATITLASLNLARMIPLMYSYDGNQYLPSLKEYMKLMLYE TVSM INFORMATION FOR NO: 26A (H64TAR6) SEQUENCE CHARACTERISTICS: LENGTH: 1665 TYPE: cDNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY LINALOOL/NEROLIDOL SYNTHASE WITH TARGET SIGNAL SEQUENCE DISCRIPTION FOR NO: 26A TCTAACCTCATGCAGCTTACACAA.A.AGAAGCAGCTTCCTACTTTTCAAAGACGGG GCATTGCCGAAGATAGCTTGCTTCCCAGTTCTACTACTCCCATAAAGCCGATGAA CGTTGAAACCAAGCATACTAGAACTATGGGTGACATTTTTGTCCAACATTCTCAGAAGTTGGAACTATTGAAAACTGTCTTGAGGAATGTAGCAGAGCTAGATGCCCTTG AAGGTTTGAATATGATCGATGCTGTTCAAAGGCTAGGCATCGATTACAACTTTCA ACGAGAAATCGACGAAATTCTGCACAAGCAAATGAGTATTGTGTCTGCCTGTGAT GATCTTCATGAGGTTGCACTTCGCTTTCGACTACTGAGACAACATGGTTACTTCG TGCCTGAAGATGTGTTTAACAACTTCAAGGACAGCAAAGGAATGTTCAAGCAAGT TCTGGGTGAAGACATCAAGGGATTGATGAGCTTATACGAAGCTTCGCAGCTAGGT ACAGAAGGAGAAGATACACTTGTTGAAGCTGAAAAGTTTAGCGGCCATCTGCTAA AGACTTCTCTGTCACATCTTGATCATCATCGAGCCAGAATTGTTGCAAATACATTG AGGAATCCTCATCACAAAAGCTTGGCCCCATTCATGGCCAGGAACTTTTTCGTTA CTTCTCAAGCCACCAATTCATGGTTAAATTTGCTAAAAGAAGTAGCAA.AAACAGA TTTCAATATGGTCCGGTCTCTGCACCAGAATGAAATAGTTCAAATTTCCAAATGG TGGAAGGAGCTTGGATTGGCTAAGGAACTGAAGTTTGCAAGAGATCAACCACTG AAATGGTACATTTGGTCCATGGCATGCCTGACAGATCCAAAGTTATCAGAGGAGA GGGTTGAGCTCACAAAACCCGTCTCTTTTGTCTATTTGATAGATGACATTTTCGAT GTTTATGGAACCCTTGATGAACTCATTCTCTTCACAGAAGCTGTTAATAGATGGG AAATTACTGCTATAGACCACTTACCAGACTACATGAAGATATGCTTCAAGGCTCT CTACGATATGACTAATGAATTCAGCAGCAAGGTCTATCTGAAGCATGGATGGAAC CCCTTACAATCTTTGA.A.A.ATTTCGTGGGCGAGTCTTTGCAATGCATTTTTGGTGG AAGCAAA.ATGGTTCGCATCTGGGCAGCTGCCGAAGTCAGAAGAGTACTTGAAGA 11~ ACGGCATCGTTTCTTCTGGGGTACATGTGGGTCTAGTCCACATGTTTTTTCTCTT GGGTCAAAACATAACCACAAAGAGTGTGGAGTTGTTGAATGAAACTCCAGCCATG ATATCGTCCTCAGCAGCAATTCTTCGACTCTGGGACGATTTAGGAAGTGCAAAGG ATGAGAACCAGGATGGGAACGATGGGTCGTATATAAGGTGCTACTTAGAGGAAC ATGAAGGCTGTTCCATCGAGGAGGCACGAGAA.A.AGACGATTAATATGATTTCAGA TGAATGGAAGAAACTGAACAGAGAACTGCTCTCTCCAAATCCATTTTCAGCAACA TTCACATTGGCTTCTCTTAATCTCGCTAGAATGATCCCCATGATGTATAGCTACGA TGGCAACCGATGCCTTCCTGATCTTAAAGAGTATGTGAAACTGATGTTGTATGAG ACTGTATCAATGTAA INFORMATION FOR NO: 26B (H64TAR6) SEQUENCE CHARACTERISTICS: LENGTH: 554 TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWEERRY LINALOOL/NEROLIDOL SYNTHASE WITH TARGET SIGNALSEQUENCE DISCRIPTION FOR NO: 26B SNLMQLTQKKQLPTFQRRGIAEDSLLPSSTTPIKPMNVETKHTRTMGDIFVQHSQ KLELLKTVLRNVAELDALEGLNMTDAVQRLGIDYNFQREIDEILHKQMSIVSACDD LHEVALRFRLLRQHGYFVPEDVFNNFKDSKGMFKQVLGEDIKGLMSLYEASQLG TEGEDTLVEAEKFSGHLLKTSLSHLDHHRARIVANTLRNPHHKSLAPFMARNFFV TSQATNSWLNLLKEVAI~TDFNMVRSLHQNEIVQISKWWKELGLAI~ELKFARDQP LKWYIWSMACLTDPKLSEERVELTKPVSFVYLIDDIFDVYGTLDELILFTEAVNRW EITAIDHLPDYMKICFKALYDMTNEFSSKVYLKHGWNPLQSLKISWASLCNAFLV EAKWFASGQLPKSEEYLKNGIVSSGVHVGLVHMFFLLGQNTTTKSVELLNETPAM TSSSAAILRLWDDLGSAI~DENQDGNDGSYIRCYLEEHEGCSIEEAREKTINMISDE WKKLNRELLSPNPFSATFTLASLNLARMIPMMYSYDGNRCLPDLKEYVKLMLYET VSM INFORMATION FOR 27A (H64TAR4) SEQUENCE CHARACTERISTICS: LENGTH: 1865 bases TYPE: cDNA STRANDNESS; Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY LINALOOL/NEROLIDOL SYNTHASE WITH TARGET SIGNAL SEQUENCE DISCRIPTION FOR : 27A CTCCCACAGCTTCTTAGTTGCTGATCATAGATCAGATGGCATCGTCTTCTCGGGC CTTCTTTAAAGTATTCAATCCTGCTCCAAAAAGCATCCCACGTATTGGCCAGTCTA ACCTCATGCAGCTTACACATAAGAAGCAGCTGCCTACTTTTCAAAGACGGGGCAT TGCCGAAGATAGCTTGCTTCCCAGTTCTACTACTCCCATAAAGCCGATGAACGTT GAAACCAAGCATACTAGAACTATGGGTGACATTTTTGTCCAACATTGTCAGAAGT TGGAACTATTCAGAAATGTCTTAAGGAATGTAGCAGAGCTAGATGCCCTTGAAGG TTTGAATATGATCGATGCTGTTCAAAGGCTAGGCATTGATTTCCACTTTCAACGA GAAATCGATGAAATTCTGCACAAGCAAATGAGTAATGTATCTGCCTCTGATGATC TTCATGAGGTTGCACTTCGCTTTCGACTACTGAGACAACATGGTTACTTCGTGCC TGAAGATGTGTTTAACAACTTCAAGGACAGCAAAGGAACGTTCAAGCAAGTTCTG GGTGAAGACATCAAGGGATTGATGAGCTTATACGAAGCTTCGCAGCTAGGTACA GAAGGAGAAGATACACTTGTTGAAGCTGAA.AAGTTTAGTGGCCATCTGCTAAAGA CTTCTCTGTCACATCTTGATCATCATCATGCCAGAATTGTTGGCAATACATTGAGG AATCCTCATCACAA.A,AGCTTGGCCTCATTCATGGCAAGGAACTTTTTCGTTACTAC TCAAGCCACCAATTCATGGTTAAATTTGCTAAAAGACGTAGCAAAAACAGATTTC AATATGGTCCGGTCTCTGCATCAGAATGAAATAGTTCAAATTTCCAAATGGTGGA AGGAGCTTGGACTGGCTAAGGAACTGAAGTTTGCAAGAGATCAACCACAGAAAT GGTACATTTGGTCCATGGCATGCCTAACAGATCCAAAGTTATCAGAGGAGAGGGT TGAGCTCACAAAACCCATTTCTTTTGTCTATTTGATAGATGACATTTTCGATGTTT ATGGAACTCTTGATGACCTCATTCTCTTCACAGAAGCTGTTAATAGATGGGAAAT TACTGCTATAGACCACTTACCAGACTATATGAAGATATGCTTCAAGGCTCTCTAT GATATGACTAATGAAATCAGCTGCAAGGTCTATCAGAAGCATGGATGGAACCCCT TACAATCTTTGAAAATTTCGTGGGCGAGTCTTTGCAATGCATTTTTGGTGGAAGC AAAATGGTTCGCATCTGGGCAGCTGCCGAAGTCAAAAGAGTACTTGAAGAACGG CATCGTTTCTTCTGGGGTTAATGTGGTTCTAGTCCACATGTTTTTTATCTTGGGTC AA.AACATAACCACAAAGAGTGTGGAGTTGTTGAATGAAACTCCAGCCATGATATC GTCCTCAGCAGCAATTCTTCGACTCTGGGACGATTTAGGAAGTGCAAAGGATGAG AACCAGGATGGGAACGATGGGTCGTATGTAAGGTGCTACTTAGAGGAACATGAA GGCTGTTCCATTGAGGAGGCACGAGAAAAGACGATTAATATGATTTCAGATGAAT GGAAGAAACTGAACAGAGAACTGCTCTCTCCAAATCCATTTCCAGCAACAATCAC ATTGGCTTCTCTTAATCTCGCAAGAATGATCCCCTTGATGTATAGCTACGATGGC AACCAATGCCTTCCATCTCTTAAAGAGTATATGAAACTGATGTTGTATGAGACTG TATCAATGTAATAATAATGACACTACTGGAAGTGGAGTTGAACTTCAA.AGGTGGTCAAGAGAAACAAGAAGCCTAAGCTGTGTCAGTGAGCTGTGACTTGGTTG INFORMATION FOR 27B (H64TAR4) SEQUENCE CHARACTERISTICS: LENGTH: 578 axnino acids TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY LINALOOL/NEROLIDOL SYNTHASE WITH TARGET SIGNAL SEQUENCE DISCRIPTION FOR : 27B MASSSRAFFKVFNPAPKSTPRIGQSNLMQLTHKKQLPTFQRRGIAEDSLLPSSTTPI KPMNVETKHTRTMGDIFVQHCQKLELFRNVLRNVAELDALEGLNMIDAVQRLGI DFHFQREIDEILHKQMSNVSASDDLHEVALRFRLLRQHGYFVPEDVFNNFKDSKG TFKQVLGEDIKGLMSLYEASQLGTEGEDTLVEAEKFSGHLLKTSLSHLDHHHARI VGNTLRNPHHKSLASFMARNFFVTTQATNSWLNLLKDVAKTDFNMVRSLHQNEI VQISKWWKELGLAKELKFARDQPQKWYIWSMACLTDPKLSEERVELTKPISFVYL IDDTFDVYGTLDDLILFTEAVNRWEITAIDHLPDYMKICFKALYDMTNEISCKVYQK 11g HGWNPLQSLKTSWASLCNAFLVEAKWFASGQLPKSKEYLKNGIVSSGVNVVLVH MFFTLGQNITTKSVELLNETPAMISSSAAILRLWDDLGSAKDENQDGNDGSYVRCY LEEHEGCSIEEAREKTINMISDEWKKLNRELLSPNPFPATITLASLNLARMIPLMYS YDGNQCLPSLKEYMKLMLYETVSM INFORMATION FOR: 28A (H64NORL) SEQUENCE CHARACTERISTICS: LENGTH: 2277 bases TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: CULTIVATED STRAWBERRY LINALOOL/NEROLIDOL SYNTHASE GENOMIC DNA FRAGMENT SEQUENCE DISCRIPTION FOR : 28A CTCCCACAGCTTCTTAGTTGCTGATCATAGATCAGATGGCATCGTCTTCTCGGGC CTTCTTTAAAGTATTCAATCCTCAAATTGCCTGCTACTTTTGAGATAGCTTGCTTC CCAGTTCTATTACTATAAAGCCGATGAACGTTGAAACCAAGCATACTAGAACTAT GGTAAAATTCTCGGAGCTTTCTCCGAAGTACATTTCTACAAAAGGGTAGAGCTAG CTACTAAACAATAGTTAATTGACTGTGCCTTGCTTGCAGGGTGACATTTTTGTCCA ACATTCTCAGAAGTTGGAACTATTGAAA.A,CTGTCTTGAGGAATGTAGCAGAGCTA GATGCCCTTGAAGGTTTGAATATGATCGATGCTGTTCAAAGGCTAGGCATCGATT ACAACTTTCAACGAGAAATCGACGAAATCCTGCACAAGCAAATGAGTATTGTGTC TGCCCGTGATGATCTTCATGAGGTTGCACTTCGCTTTCGACTACTGAGACAACAT GGTTACTTCGTGCCTGAAGGTAAGTTTAATCACACGTATTATTTTTCGTTCGCTAA ACGATATGAAACTATTTCATTCATAAACAGTTGTA.A.A.ACTTGTGTAGTAATACATA TTTCTACGTGTTTGTTACAGATGTGTTTAACAACTTCAAGGACAGCAAAGGAACG TTCAAGCAAGTTCTGGGTGAAGACATCAAGGGATTGATGAGCTTATACGAAGCTT CGCAGCTAGGTACAGAAGGAGAAGATATACTTGTTGAAGCTGAAAAGTTTAGCG GCCATCTGCTAAAGACTTCTCTGTCACATCTTGATCATCATCGAGTCAGAATTGTT GCAAATACATTGAGGAATCCTCATCACAA.A.AGCTTGGCCCCATTCATGGCCAGGA ACTTTTTCGTTACTTCTCAAGCCACCAATTCATGGTTAAATTTGCTAAAAGAAGTA GCAAAA.ACAGATTTCAATATGGTCCGGTCTCTGCACCAGAATGAAATAGTTCAAA TGTCCAAGTAAGTTTGACAATGACTTCACCAGTGTCAGGACATTGATACTTTAATT CACACAGGAGATACTTAGTGTAATTATGTGTATTTTTGACATTGTAGATGGTGGA AGGAGCTTGGATTGGCTAAGGAACTGAAGTTTGCAAGAGATCAACCACTGAAAT GGTACATTTGGTCCATGGCATGCCTGACAGATCCAAAGTTATCAGAGGAGAGGG TTGAGCTCACAAAACCCATCTCTTTTGTCTATTTGATAGATGACATTTTCGATGTT TATGGAACCCTTGATGACCTCATTCTCTTCACAGAAGCTGTTAATCGGTATATATG AATTATATGCGTCAGTGATGAAATATAATCAGACTTGTTACCAATTTATGATTGAT CAACAACCTATTGCATACATACAGATGGGAAATTACTGCTATAGACCACTTACCA GACTATAtGAAGATATGCTTCAAGGCTCTCTATGATATGACTAATGAATTCAGCAG CAAGGTCTATCTGAAGCATGGATGGAACCCCTTACAATCTTTGAA.AATTTCGGTA CATAACTATATATACAAACTGTGACTAATCTATCACATTTAACTTGATTATCGTTA AAATCGTGAGCTTGGATTACAAGGTTTACATTGAGACCATTCATTCTGTAACTTCT GTTGCAGTGGGCGAGTCTTTGCAATGCATTTTTGGTGGAAGCA.A.AAATGGTTCGC CTCTGGGAAGCTGCCGAAGTCAGAAGAGTACTTGAAGAATGGCATCGTTTCTTCT GGGGTAAATGTGGTTCTAGTCCACATGTTTTTTCTCTTGGTCAGAACAAACCAGA AAGAGTGTGGAGTTGTTGAATGAAA.CTCCAGCCATTATATCGTCCTCAGCAGCAA TTCTTCGACTCTGGGACGATTTAGGAAGTGCAAAGGATGAGAACCAGGATGGGA ACGATGGGTCGTATGTAAGGTGCTACTTAGAGGAA.CATGAAGGCTGTTCCATTGA GGAGGCACGAGAAAAGACGATTAATATGATTTCAGATGAATGGAAGAAACTGAA CAGAGAACTGCTCTCTCCAAATCCATTTCCAGCATCATTCACATTGGCTTCTCTTA ATCTCGCAAGAATGATCCCCTTGATGTATAGCTACGATGGCAACCAATGCCTTCC ATCTCTTAAAGAGTATATGAAACTGATGTTGTATGAGACTGTATCAATGTAATTAA TAATAAGACTACCGGAAGTGGAGTTGAACTTCAAAGGTGGGTGGTCAAGAGAA.A CAAGAAGCCTAAG INFORMATION FOR 29 (E1) SEQUENCE CHARACTERISTICS: LENGTH: 227 bases TYPE: Genomic DNASTRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA from both sides of the methionine residues SEQUENCE DISCRIPTION FOR : 29Ato GGCCGCGGGAATTCTATTCGCTGATCATAGATCAGATGGCATTGTCTACTCGGG CCTTCTTTAAAGTATTCAATCCCCAAATTACTCCAAACAGTATCTCACATATTGGC CAGTCTAACCTCATGCAGCTTACACAAAAGAAGCAGCTTCCTACTTTTCAAAGAC GGGGCATTGCCGAAGATAGCTTGCTTCCCAGTTCTACTACTCCCATAAAGCCGAT GCACGTT INFORMATION FOR: 29B (E1) SEQUENCE CHARACTERISTICS: LENGTH: 64 amino acids TYPE: Peptide STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA from both sides of the methionine residues SEQUENCE DISCRIPTION FOR : 29B MALSTRAFFKVFNPQITPNSISHIGQSNLMQLTQKKQLPTFQRRGIAEDSLLPSSTTPIKPMHV INFORMATION FOR: 30A (E2) SEQUENCE CHARACTERISTICS: LENGTH: 201 bases TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA from both sides of the methionine residues SEQUENCE DISCRIPTION FOR : 30A CCGCGGGAATTCGATTTGCTGATCATAGATCAGATGGCATAGTCTTTTCGGTCCC TCTTTAAAGTATTCAATCAAATTGCTCCAAAAATTAACTCACATGTTGGCCACTCT AAGAAGCAGCTGCCTGCTACTTTTCAAAGATGGGGCGTTGCCGAAGATAGCTTGC TTTCCAGTTCTAGTACTATAAAGCTGATGCACGTT INFORMATION FOR: 31A (E3) SEQUENCE CHARACTERISTICS: LENGTH: 141 bases TYPE: Genomic DNA STRANDNESS: Single TOPOLOGY: Linear OTHER INFORMATION: Fragment from PCR on genomic DNA from both sides of the methionine residues SEQUENCE DISCRIPTION FOR: 31A CCGCGGGAATTCGATTTGCTGATCATAGATCAGATGGCATCGTCTTCTCGGGCCT TCTTTAAAGTATTCAATCCTCAAATTGCCTGCTACTTTTGAGAAAGCTTGCTTCCC AGTTCTATTACTATAAAGCCGATGCACGTT

权利要求:
Claims (54)
[1] 1. An isolated or recombinant nucleic acid or functional fragment thereof encoding a proteinaceous molecule essentially capable of isoprenoid bio-active compound synthesis when provided with a suitable substrate under appropriate reaction conditions.
[2] 2. A nucleic acid or functional fragment thereof according to claim 1 wherein said nucleic acid encodes a proteinaceous molecule essentially capable of synthesizing at least a monoterpene alcohol linalool when contacted with geranyl diphosphate (GPP) and/or at least a sesquiterpene alcohol nerolidol when contacted with farnesyl diphosphate (FPP) under appropriate reaction conditions.
[3] 3. A nucleic acid according to claims 1 or claim 2 wherein said proteinaceous molecule comprises a terpene synthase/cyclase.
[4] 4. A nucleic acid according to claim 3 wherein said proteinaceous molecule comprises a sesquiterpenoid synthase/cyclase.
[5] 5. A nucleic acid according claim 4 wherein said proteinaceous molecule comprises a nerolidol synthase/cyclase protein or functional fragment thereof.
[6] 6. A nucleic acid according to claim 5 wherein said nerolidol synthase/cyclase comprises nerolidol synthase.
[7] 7. A nucleic acid according to anyone of claims 1-3 wherein said sesquiterpene alcohol nerolidol comprises trans-nerolodol.
[8] 8. A nucleic acid according to anyone of claims 1-6 wherein said monoterpene alcohol comprises linalool.
[9] 9. A nucleic acid according to anyone of claims 1-8 wherein said nucleic acid encodes a proteinaceous molecule comprising an amino acid sequence or functional fragment thereof that is at least 50% identical to H64MUT sequence as shown in figure 2 or functional fragment thereof.
[10] 10. A nucleic acid or functional fragment thereof according to claim 1 wherein said nucleic acid encodes a proteinaceous molecule essentially capable of the synthesis of at least one monoterpenoid when contacted with geranyl diphosphate (GPP) under appropriate reaction conditions.
[11] 11.A nucleic acid according to claim 10 wherein said monoterpenoid comprises .alpha.-pinene, .beta.-pinene, sabinene, .beta.-myrcene, .alpha.-phellandrene, .beta.-phellandrene, .alpha.-terpinolene, .alpha.-terpineol, .gamma.-terpinene and/or dihydromyzcenol.
[12] 12.A nucleic acid according to claim 10 or claim 11 wherein said proteinaceous molecule comprises a monoterpenene synthase/cyclase.
[13] 13.A nucleic acid according to anyone of claims 10-12 wherein said nucleic acid encodes a proteinaceous molecule comprising an amino acid sequence or functional fragment thereof that is at least 50% identical to SOSV sequence as shown in figure 7.
[14] 14.A nucleic acid according to anyone of claims 1-13 obtainable from a eukaryote, preferably a plant.
[15] 15.A nucleic acid according to anyone of claims 1-13 obtainable from an invertebrate animal.
[16] 16. A nucleic acid according to anyone of claims 1-15 provided with a nucleic acid encoding a plastid targeting signal.
[17] 17.A nucleic acid according to anyone of claims 1-15 provided with a nucleic acid encoding a mitochondrial targeting signal.
[18] 18.A nucleic acid according to anyone of claims 1-15 encoding a proteinaceous molecule essentially capable of isoprenoid bio-active compound synthesis in the cytosol in a cell when provided with a suitable substrate under appropriate reaction conditions.
[19] 19.A nucleic acid according to anyone of claims 1-15 encoding a encoding a proteinaceous molecule essentially capable of isoprenoid bio-active compound synthesis in a plastid in a cell when provided with a suitable substrate under appropriate reaction conditions.
[20] 20.A nucleic acid according to anyone of claims 1-15 encoding a encoding a proteinaceous molecule essentially capable of isoprenoid bio-active compound synthesis in a mitochondrium in a cell when provided with a suitable substrate under appropriate reaction conditions.
[21] 21.A proteinaceous molecule encoded by nucleic acid according to anyone of claims 1-20.
[22] 22.A vector comprising a nucleic acid according to anyone of claims 1-20.
[23] 23.A host comprising a nucleic acid according to anyone of claims 1-20 or a vector according to claim 21.
[24] 24.A host according to claim 23 wherein said vector according to claim 22 and the host expresses a nerolidol synthase/cyclase protein or polypeptide.
[25] 25.A host according to claim 23 wherein said vector according to claim 22 and the host cell expresses a monoterpenene synthase/cyclase protein or polypeptide.
[26] 26.A plant or propagating material derived thereof which comprises a nucleic acid according to anyone of claims 1-20 or a vector according to claim 22.
[27] 27.A method for producing a flavor, fragrance and/or bio-control agent comprising a) transforming or transfecting a suitable host with at least one nucleic acid encoding a proteinaceous molecule according to anyone of claims 1-20 b) expressing said nucleic acid in the presence of a suitable substrate c) optionally isolating the formed product.
[28] 28.A method according to claim 27 wherein said host comprises a microorganism, plant cell or plant.
[29] 29.A method for producing a flavor, fragrance and/or bio-control agent in a cell-free lysate expression system comprising expressing at least one nucleic acid encoding a proteinaceous molecule according to anyone of claims 1-20 in the presence of a suitable substrate and optionally isolating the formed product.
[30] 30.A compound such as a flavor, fragrance and/or bio-control agent obtainable by a method according to anyone of claims 22-29.
[31] 31.Use of a compound according to claim 30 as an anti-microbial agent.
[32] 32.Use of a compound according to claim 30 in the processed food industry as a food additive to modify the taste of syrups, ice-creams, frozen desserts, yogurts, confectionery and like products.
[33] 33.Use of a compound according to claim 30 as a flavoring agent for oral medications and vitamins.
[34] 34.Use of a compound according to claim 30 for providing additional flavor/aroma in beverages, including alcoholic beverages.
[35] 35.Use of a compound according to claim 30 for enhancing or reducing plant flavor/aroma/fragrance/scent.
[36] 36.Use of a compound according to claim 30 for enhancing the flavor/aroma of natural products and/or synthetic and/or artificial products.
[37] 37.Use of a compound according to claim 30 for the industrial synthesis of nature identical flavor/aroma substances and/or artificial flavor/aroma substances.
[38] 38.Use of a compound according to claim 30 as a pest control agent.
[39] 39.Use of a compound according to claim 30 for the biological control of the interaction between plants and insects and/or the interaction between plants and micro-organisms.
[40] 40.Use of a compound according to claim 30 for providing flavor/aroma in cosmetics, creams, sun-protectant products, hair conditioners, cleaning products, personal care products and health care products.
[41] 41.Use of a compound according to claim 30 as a disinfectant additive.
[42] 42.Use of a nucleic acid or fragment thereof encoding a proteinaceous molecule according to anyone of claims 1-20 as a molecular marker or diagnostic tool.
[43] 43.Use of a proteinaceous molecule according to claim 21 for the production of an antagonist.
[44] 44.Use of a proteinaceous molecule according to claim 21 for the production of an antagonist wherein said antagonist is an antibody or functional equivalent thereof.
[45] 45.Use of a proteinaceous molecule according to claim 21 production of an antagonist to inhibit the synthesis of a compound according to claim 30.
[46] 46.Use of a compound according to claim 30 for the preparation of a composition.
[47] 47.A composition comprising a flavor, fragrance and/or bio-control agent according to claim 30.
[48] 48.A composition according to claim 47 which is a pharmaceutical.
[49] 49.A composition according to claim 47 which is a nutraceutical.
[50] 50.Use of a composition according to claim 47 for augmenting or enhancing the aroma and/or taste of food or non food products and/or protection of food or non food products against fungal contamination and/or pest infestation.
[51] 5l.Use of a composition according to claim 47 for the biological control of pests.
[52] 52.Use of a composition according to claim 47 for the protection of stored products.
[53] 53. Use of a composition according to anyone of claim 47-49 for the prevention or treatment of disease.
[54] 54. A method of treatment of disease comprising administering a composition according to anyone of claims 47-49 with a carrier to a suitable recipient.

类似技术:

---

公开号 | 公开日 | 专利标题

---

US8338663B2|2012-12-25|Isoprenoid synthases

---

Aharoni et al.2003|Terpenoid metabolism in wild-type and transgenic Arabidopsis plants

---

Hipskind et al.2000|Constitutive accumulation of a resveratrol-glucoside in transgenic alfalfa increases resistance to Phoma medicaginis

---

Bouvier et al.2000|Molecular cloning of geranyl diphosphate synthase and compartmentation of monoterpene synthesis in plant cells

---

US9572349B2|2017-02-21|Repellent compositions and genetic approaches for controlling huanglongbing

---

KR20120007038A|2012-01-19|Plant snf1-related protein kinase gene

---

US7154022B2|2006-12-26|Divinyl ether synthase gene, and protein and uses thereof

---

AU747075B2|2002-05-09|Sesquiterpene synthases from grand fir abies grandis, and methods of use

---

Zhou et al.2021|Degradation of salicylic acid to catechol in Solanaceae by SA 1-hydroxylase

---

US20140173771A1|2014-06-19|Transcription factor modulating terpene biosynthesis

---

US6974895B1|2005-12-13|Transgenic legume plants modified to produce resveratrol glucoside and uses thereof

---

EP0858507A2|1998-08-19|Use of linalool synthase in genetic engineering of scent production

---

CA2437863C|2013-05-28|Isoprenoid synthases

---

Ramirez2013|Pyrethrum secondary metabolism: biosynthesis, localization and ecology of defence compounds

---

CA2360365A1|2000-08-03|Transgenic plants modified to contain resveratrol glucoside and uses thereof

---

Lybrand2020|Secretory Glandular Trichomes: Analysis and Engineering of Plant Specialized Metabolism

---

US20110225682A1|2011-09-15|Polynucleotides encoding caryophyllene synthase and uses thereof

---

Huh2011|Biochemical, molecular and functional analysis of volatile terpene formation in Arabidopsis roots

---

Lücker2002|Metabolic engineering of monoterpene biosynthesis in plants

---

Kohlen2011|Regulation of biosynthesis and transport of strigolactones and their effect on plant development

---

Lashbrooke2010|Functional analysis of a grapevine carotenoid cleavage dioxygenase |

---

Ginglinger et al.0|Gene Coexpression Analysis Reveals Complex Metabolism of the Monoterpene Alcohol Linalool in Arabidopsis FlowersW OPEN

---

Nieuwenhuizen et al.0|Functional Genomics Reveals That a Compact Terpene Synthase Gene Family Can Account for Terpene Volatile

---

Haider et al.0|β-carotene isomerase, DWARF27, links abscisic acid to the strigolactones

同族专利:

---

公开号 | 公开日

---

CA2437863C|2013-05-28|

引用文献:

---

公开号 | 申请日 | 公开日 | 申请人 | 专利标题

---

法律状态:
2007-01-31| EEER| Examination request|

---

2017-03-27| MKLA| Lapsed|Effective date: 20170213 |

优先权:

---

申请号 | 申请日 | 专利标题

---

EP01200488.3||2001-02-12||

---

EP01200488A|EP1231273A1|2001-02-12|2001-02-12|Terpene synthase/cyclase and olefin synthase and uses thereof|

---

PCT/NL2002/000089|WO2002064764A2|2001-02-12|2002-02-12|Terpene synthase/cyclase and olefin synthase and uses thereof|

---